(data stored in ACNUC7421 zone)

EMBL: AP010803.PE155

AP010803.PE155       Location/Qualifiers
FT   CDS_pept        complement(162534..163514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="SJA_C1-01550"
FT                   /product="tellurite resistance protein TerC"
FT                   /note="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94989"
FT                   /db_xref="GOA:D4YXA7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA7"
FT                   /protein_id="BAI94989.1"
FT                   /translation="MEFLFADWLGTPAWFWLAFFSIVVALTAFDLGFLHKENKEIGIRE
FT                   SLKLSIFYIGIACAFGAWVWFVRGPEPGMQYFTGFFIEKALSIDNVFVISLIFTYFAIP
FT                   AKYQYRALLWGIIGVIVLRGLMIAGGAMLLHQAYWVLYLFAAFLIFTGIRMMFAGDEPM
FT                   DVGKNPLIRFISKHMRVTPEQHGEHFLARMTDPKTGKVVMAATPLLLALVVINFADLVF
FT                   AVDSVPAIFAITTDMFIVYTSNVMAILGLRALYFALAAMVHRFHYLKYALAAILVFIGA
FT                   KIFVADFVMDGGKFPPVISLGVTFALIGVGVGWSLWKTRGEEKLA"
     atggaatttc ttttcgccga ctggctgggg acgcccgcat ggttctggct cgcctttttc        60
     tccatcgtcg tcgcgctgac cgccttcgac ctgggtttcc tgcacaagga gaacaaggag       120
     atcggcatca gggagagcct gaagctctcc atcttctaca tcggcatcgc ctgcgctttc       180
     ggcgcctggg tctggttcgt gcgcgggccg gagccgggga tgcagtattt caccggcttc       240
     ttcatcgaaa aggcgctgtc catcgacaat gtcttcgtca tcagcctgat cttcacctat       300
     ttcgcgattc cggcgaaata tcagtatcgg gcgctgctgt ggggcattat cggcgtgatc       360
     gtgctgcgcg gcctgatgat cgcgggcggg gcgatgctgc tgcaccaggc ctattgggtg       420
     ctgtacctgt tcgccgcctt cctgatcttt accggcatca ggatgatgtt cgcgggcgac       480
     gagccgatgg atgtcggcaa aaatccgctg atccgcttca tttcgaagca tatgcgagtg       540
     acgccggagc agcatggcga gcatttcctg gcgcgcatga ccgatccgaa gaccggcaag       600
     gtcgtcatgg cggcgacgcc cctgctgctg gcgctggtgg tgatcaactt cgcggacctg       660
     gtgttcgcgg tggacagcgt gcccgccatc ttcgcgatca cgaccgacat gttcatcgtc       720
     tacacgtcga acgtgatggc gatattgggc ctgcgcgcgc tctatttcgc gctggcggcg       780
     atggtgcatc gcttccacta tctgaaatat gcgctggccg cgatattggt gttcatcggc       840
     gccaagatat tcgtggcgga cttcgtgatg gacgggggca aattcccgcc cgtcatcagc       900
     cttggcgtga ccttcgcgct gatcggcgtg ggggtgggct ggtcgctgtg gaagacgcgg       960
     ggcgaggaaa agctcgccta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page