(data stored in ACNUC7421 zone)

EMBL: AP010803.PE156

AP010803.PE156       Location/Qualifiers
FT   CDS_pept        complement(163894..165753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01560"
FT                   /product="ATP-binding cassette protein"
FT                   /note="subfamily B, bacterial / ABC-type transport system
FT                   involved in Fe-S cluster assembly, permease and ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94990"
FT                   /db_xref="GOA:D4YXA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA8"
FT                   /protein_id="BAI94990.1"
FT                   /translation="MPPSTPDNSPLPPVWATMRRFFPYLWPADAPALRRRVAVAMALVL
FT                   VAKAVSLAMPFAYKGAIDRMAPGMESGAGLAIALVVAYAGARFGGVLFDNLRNAIFERV
FT                   GQEAGRRLADDVFVHLHRLSLRFHLDRRTGAVTKIVERGTKSIDTMLYFLLFNIAPTVL
FT                   ELAAVCVIFFVKFGPGLVAATLVMVALYIWFTRTITEWRNQLRRDMVDMDTNAVAHAVD
FT                   SLLNFETVKYFGAEEREAARYAKAMRRYANAAVKSENSLAWLNIGQSLITNLMMAGAMG
FT                   YTVWGWSRGQFSTGDVVLVNTLLSQLFRPLDLLGMVYRTIRQGLIDMEAMYRLIDTQAE
FT                   ISDAPGAPMLHVEAGEVRFDHVHFGYDPEREILHGVSFTVPAGRTLAIVGPSGAGKSTI
FT                   ARLLFRFYDIQGGRISVDGQDISAVTQQSLRSTIGIVPQDMVLFNDTVGYNIGYGREGA
FT                   TQEEIEAAARAASIHDFIMGLPQGYDTRVGERGLKLSGGEKQRVAIARTLLKDPPVLVL
FT                   DEATSALDSRTETEIQDVLRTISRRRTTLVVAHRLSTVVDADEIIVMEKGRIVERGRHG
FT                   DLVRADGLYAAMWARQATERDDMPVEPGIEDIFEVVDVPGGRG"
     atgccgccat ccacgcccga caatagcccc cttccgcccg tctgggcgac gatgcggcgt        60
     ttctttcctt atctctggcc ggccgacgcc cccgcgctgc ggcggcgcgt cgccgtcgcc       120
     atggcgctgg tgctggtggc gaaggccgtc agcctggcca tgcccttcgc ctataagggc       180
     gcgatcgacc gcatggcgcc gggcatggaa tccggcgcgg gcctcgccat cgcgctggtc       240
     gtcgcctatg cgggggcgcg ctttggcggc gtgctgttcg acaatctgcg caacgccatt       300
     ttcgagcggg tcgggcagga ggccgggcgg cggctggccg acgacgtgtt cgtccacctg       360
     caccggctgt cgctgcgctt ccatctcgac cggcgcaccg gggccgtcac caagatcgtg       420
     gagcgcggca ccaagagcat cgacaccatg ctctatttcc tgctgttcaa catcgcgccg       480
     acggtgctgg aactggcggc ggtctgcgtc atcttcttcg tgaagttcgg tcccggactg       540
     gtggcggcga cgctggtcat ggtggcgctc tacatctggt tcacccggac gatcaccgaa       600
     tggcgcaacc agctccgccg cgacatggtg gacatggaca ccaacgcggt cgcccatgcg       660
     gtcgacagcc tgctgaattt cgagacggtc aaatatttcg gcgcggagga gcgcgaagcg       720
     gcccgctatg ccaaggcgat gcggcgctat gccaatgcgg cggtgaagtc ggaaaattcg       780
     ctcgcctggc tgaatatcgg ccagtcgctg atcaccaacc tgatgatggc gggggcgatg       840
     ggctataccg tctgggggtg gagccggggg cagttctcga ccggcgacgt ggtgctggtg       900
     aacacgctgc tgagccagct tttccggccg ctcgacctgc tggggatggt ctatcggacg       960
     atccggcagg ggctgatcga tatggaggcg atgtacaggc tgatcgacac gcaggcggag      1020
     atcagcgacg caccgggcgc gccgatgctg catgtggagg cgggcgaggt gcgcttcgat      1080
     catgtgcatt tcggttacga tccggaacgg gagatattgc atggcgtcag cttcaccgtt      1140
     ccggcgggca ggacgctggc catcgtcggg ccttcgggcg cgggcaagtc gaccatcgcc      1200
     cggctgctgt tccgattcta cgacattcag ggcgggcgga tcagcgtcga cgggcaggac      1260
     atatcggcgg tgacgcagca atccctgcgc tccaccatcg gcatcgtgcc gcaggacatg      1320
     gtgctgttca acgacacggt cggctataat atcggctatg gccgcgaagg cgcgacgcag      1380
     gaagagatcg aggcggcggc cagagcggcg tccatccacg acttcatcat gggcctgccg      1440
     cagggctatg acacgcgggt gggcgagcgc gggttgaagc tgtccggcgg cgagaagcag      1500
     cgggtggcga ttgcccggac gctgctgaaa gacccgccgg tgctggtgct ggacgaggcg      1560
     accagcgcgc tcgacagccg gacggagacg gaaatccagg acgtgctgcg caccatatcg      1620
     cgcaggcgca cgacgctggt ggtggcgcac cggctgtcca ccgtggtcga cgcggacgag      1680
     atcatcgtca tggagaaggg gcgcatcgtc gagcgcgggc ggcatggcga tctggtgcgg      1740
     gcggacgggc tgtacgccgc catgtgggcg cgacaggcga ccgagcggga cgacatgccg      1800
     gtcgagccgg ggatcgagga tattttcgaa gtggtggacg tgccgggcgg cagggggtga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page