(data stored in ACNUC7421 zone)

EMBL: AP010803.PE159

AP010803.PE159       Location/Qualifiers
FT   CDS_pept        complement(167646..168227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01590"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="putative Rossmann fold nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94993"
FT                   /db_xref="GOA:D4YXB1"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB1"
FT                   /protein_id="BAI94993.1"
FT                   /translation="MKRLAVYCGSATPADPAYVDAARHVGRVLARRGIGVVYGGGRLGL
FT                   MGAVADAALEAGGEVIGVIPEALVGAEVAHRGCTELRVVQTMHQRKQLFTDLSDGFVTL
FT                   PGGVGTMDELWEAISWAQLGYHQKPVGLLNVAGFYDQLIAFNQHMVEAGFIRAQHANIL
FT                   IHANAVEALLDRMAAYQPHETVFAMKADRL"
     atgaagagac tggcagtcta ttgcggctcg gccaccccgg ccgaccccgc ctatgtcgac        60
     gccgcccgcc atgtcgggcg cgtcctggcg cggcgcggca tcggcgtcgt ctatggcggc       120
     ggtcgcctgg gcctgatggg cgcggtggcg gatgcggcgc tggaggcggg cggcgaagtg       180
     atcggggtca tccccgaagc gctggtcggc gccgaagtcg cccatcgcgg ctgcaccgaa       240
     ctgcgcgtcg tccagaccat gcaccagcgc aagcagcttt tcaccgacct gtccgacggc       300
     ttcgtcaccc tgcctggcgg cgtcggcacg atggacgaat tgtgggaagc gatcagttgg       360
     gcgcagcttg gttatcacca aaagccggtg ggcctgctca atgtcgcggg cttctacgac       420
     cagcttatcg ccttcaacca gcatatggtg gaggcaggct tcatccgcgc ccagcacgcc       480
     aatatcctga tccacgccaa cgccgtcgaa gccttgctcg acaggatggc ggcctatcag       540
     ccccacgaaa ccgtcttcgc gatgaaggcg gatcggctct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page