(data stored in ACNUC7421 zone)

EMBL: AP010803.PE162

AP010803.PE162       Location/Qualifiers
FT   CDS_pept        170929..171081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94996"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB4"
FT                   /protein_id="BAI94996.1"
FT                   /translation="MPHRPTPHPATQRQYSMGGRVGEWAGAAPKMYICAFSKQTLRGFA
FT                   RKCTD"
     ttgccgcacc ggcccactcc ccaccctgcc acccaacggc agtattctat gggtggccgg        60
     gtgggggagt gggccggtgc ggcgccgaaa atgtacatat gcgcattttc caaacagact       120
     cttaggggct tcgcgaggaa atgcacggat tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page