(data stored in ACNUC7421 zone)

EMBL: AP010803.PE163

AP010803.PE163       Location/Qualifiers
FT   CDS_pept        171115..171387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01630"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94997"
FT                   /db_xref="GOA:D4YXB5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB5"
FT                   /protein_id="BAI94997.1"
FT                   /translation="MHIVADRDKLLARVRRIAGQIGAVERQLAGDAGCSETLQLVASVR
FT                   GAVGSLMEELIDQHMREHVARPGISDAARQAAAEEMLALIRRYGK"
     atgcatatcg tggcggatcg ggacaagctg ttggcgcggg tgcggcgcat agccgggcag        60
     atcggcgcgg tcgaacggca attggcgggt gatgcaggct gttcggaaac gctgcaactg       120
     gtcgcctccg tccggggagc cgtgggcagc ctgatggagg agctgatcga ccagcatatg       180
     cgcgaacatg tcgcccggcc gggcatcagc gacgcagcgc gacaggccgc ggcggaggag       240
     atgctggcgc tgatccggcg ctacgggaaa tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page