(data stored in ACNUC7421 zone)

EMBL: AP010803.PE164

AP010803.PE164       Location/Qualifiers
FT   CDS_pept        171384..172370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01640"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94998"
FT                   /db_xref="GOA:D4YXB6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB6"
FT                   /protein_id="BAI94998.1"
FT                   /translation="MSMHDDHDHGHHPEEHDHARAMPATGADDGEESHYFDHIYLSRGH
FT                   DENARKTMWVVWLTAATMVVEIVFGWLSGSMALLADGFHMATHAGALAVAAAAYGYARR
FT                   HARNPRYTFGTGKVGDLSGFASALILAFTALFIAVESAMRLFDPVQVAFGEATLVAVIG
FT                   LVINLISALLLGHDHSHDHGHHGHAHDHKQGHADNNLRAAYMHVLTDALTSVLAITALL
FT                   AGRYMGWWWLDPAVGLLGAAVIARWAWGLMKDTAAILLDTAEPALTARIKGLVEAEGAT
FT                   IRDLHVWRIGPHAHAAIVSLAPGADAAAVRRQVRALPRMEHVTVECG"
     atgagcatgc atgacgatca cgaccatggc catcatcccg aggagcatga tcatgcccgt        60
     gccatgcccg cgaccggcgc ggacgatggg gaggagagcc attatttcga ccatatctat       120
     ctgagccggg ggcatgacga gaatgcccgc aagacgatgt gggtcgtgtg gctgacggcg       180
     gcgaccatgg tggtggagat cgtcttcggc tggctgagcg ggtcgatggc gctgctggcc       240
     gatggcttcc acatggcgac ccatgcgggc gcgctggcgg tggcggcggc tgcctatggc       300
     tatgcgcggc ggcatgcgcg caatccgcgc tatactttcg ggaccggcaa ggtgggggat       360
     ctgtccggct tcgcctccgc gctgatcctg gccttcacgg cgctgttcat cgccgtcgaa       420
     tcggcgatgc gcctgttcga cccggtgcag gtggctttcg gcgaagcgac gctggtggcg       480
     gtgatcggcc tggtcatcaa cctgatcagc gccctgctgc tggggcatga ccatagccat       540
     gatcacgggc atcacggcca tgcccatgat cataagcagg gccatgccga caataatctg       600
     cgcgccgcct atatgcatgt gctgaccgac gcgctgacgt ccgtgttggc catcacggcg       660
     ctgctggcgg ggcgctatat gggttggtgg tggctggacc cggccgtggg cctgctgggc       720
     gcggcggtga tcgcgcgctg ggcctggggg ctgatgaagg ataccgccgc gatcctgctc       780
     gacaccgccg aaccggcgct gacggcgcgg atcaagggac tggtggaggc ggagggggcg       840
     accatccgcg acctgcatgt ctggcgcatc gggccgcatg cccatgccgc catcgtcagc       900
     ctggcccccg gcgcggacgc cgccgccgtg cgccgccagg tccgcgccct gccgcgcatg       960
     gagcatgtga cggtggagtg cgggtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page