(data stored in ACNUC7421 zone)

EMBL: AP010803.PE166

AP010803.PE166       Location/Qualifiers
FT   CDS_pept        complement(173749..174177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01660"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95000"
FT                   /db_xref="GOA:D4YXB8"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB8"
FT                   /protein_id="BAI95000.1"
FT                   /translation="MFRQLTKSLYVSPQISVDQVAEAKALGVTVIINNRPDDEEPGQTN
FT                   GAEIEAAAKAAGIAYAAVPVAHGGFSPWQLDGMAAALEQAGEGKILAYCRSGTRSTLLW
FT                   ALTRARAGDHPAALAEQAASAGYDVAPVRQIMDALAAG"
     atgttccgcc agcttaccaa aagcctctac gtctccccgc agatcagcgt cgatcaggta        60
     gcggaggcca aggcgctggg cgtcaccgtc atcatcaaca accgccccga cgacgaggaa       120
     ccgggccaga ccaacggcgc ggagatcgaa gccgccgcca aggccgccgg catcgcctat       180
     gccgccgtgc ccgtggccca tggcggcttc tccccctggc aactcgacgg catggccgcc       240
     gcgctggaac aggcgggcga gggcaagatc ctcgcctatt gccgctccgg cacgcgcagc       300
     acattgctct gggcgctgac ccgcgcccgc gcaggcgatc acccggcggc gctggccgag       360
     caggccgcct cggccggata tgacgtcgcg cccgtccgcc agatcatgga cgcgctcgcc       420
     gccggttga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page