(data stored in ACNUC7421 zone)

EMBL: AP010803.PE168

AP010803.PE168       Location/Qualifiers
FT   CDS_pept        complement(176481..176795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95002"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC0"
FT                   /protein_id="BAI95002.1"
FT                   /translation="MSGRRKWIYGALAAVLLPLALLAWNWSALRAQAQVGAGFGARVTC
FT                   SCRYVEGRSMESCKGDKEPGMWAVSLKDLPESQSVNAAVPLLASRTARYRKGWGCLLDP
FT                   "
     atgtccggtc gccggaaatg gatttacgga gctttggcgg cggtgctgct gccgctggcg        60
     ctgctggcct ggaactggag cgccctgcgt gcccaggcgc aggtcggcgc gggcttcggc       120
     gcgcgcgtaa cctgctcctg ccgctatgtg gaagggcggt cgatggaaag ctgcaagggc       180
     gacaaggaac ccggcatgtg ggccgtgtcg ctgaaggact tgcccgaatc gcaatcggtc       240
     aacgcggcgg ttccgctgct cgcctcccgc acggcgcgct atcgcaaggg ctggggctgc       300
     ctgctggacc cttga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page