(data stored in ACNUC7421 zone)

EMBL: AP010803.PE169

AP010803.PE169       Location/Qualifiers
FT   CDS_pept        176834..177958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01690"
FT                   /product="putative beta-lactamase class C"
FT                   /EC_number="3.5.1.46"
FT                   /note="penicillin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95003"
FT                   /db_xref="GOA:D4YXC1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC1"
FT                   /protein_id="BAI95003.1"
FT                   /translation="MRLERNSVKRLGALGGILAVLAVAGLWTVRAAAGPEPVYHVAGDS
FT                   DADAATLRAAIDPLFDDAVGETRALVIMHDGEIVAERYAPGYGPRTKLPSWSAAKSVTA
FT                   VLIGLMVSDGRLALDSPVPVAAWGQPGDPRGRITLRQLLAMTSGLDHVEDAEPLAEADT
FT                   IRMLFTDGAQDMGAFAEAKPLAHAPGAAFSYSTGNSVILADLMARMLTNSTDPDVRRRA
FT                   MQMFIDGRLKIPARLDSLTVEYDAAGTMIGGSFMHMTARDYARFGELLRNHGRGAAGHQ
FT                   IVPEKWIDHMREPSPRNAAYGAHLWLNRDSEDSALMPGRAPRSLFGCVGHGGQYILVSP
FT                   SQRLTVVRLGMSPRKEERAALKAELAKLVGLYAR"
     atgaggcttg agcggaacag cgtaaagcgc cttggcgcgt tgggcgggat tttggcggtg        60
     ctggcggtgg ccgggctgtg gaccgtgcgc gccgccgccg ggccggagcc ggtctatcat       120
     gtcgcgggcg attcggacgc ggacgcggcg acgctgaggg cagcgatcga cccgctgttc       180
     gacgatgcgg tgggcgaaac gcgagcgctg gtcatcatgc acgacggaga gatcgtggcg       240
     gagcgctatg cgcccggcta tgggccgcgg acgaagctgc cgtcctggtc cgcggccaag       300
     agcgtgacgg cggtgctgat cgggctgatg gtgtcggacg ggcggctggc gctcgattcg       360
     ccggtgccgg tggcggcctg gggccagccg ggcgatccca gggggcgcat caccctgcgc       420
     cagttgctgg ccatgacgtc cggcctggac catgtcgagg atgccgaacc gctggcggag       480
     gccgacacga taaggatgct gttcaccgac ggcgcgcagg acatgggcgc ctttgcggag       540
     gcaaagccgc tggcccatgc gccgggcgcc gccttttcct attcgaccgg caacagcgtc       600
     atcctggccg acctgatggc gcggatgctg accaacagca ccgatcccga cgtgcggcgg       660
     cgggcgatgc agatgttcat cgacggccgg ctgaagatcc cggcgcggct cgacagcctg       720
     accgtggaat atgatgcggc agggacgatg atcggcggca gcttcatgca tatgacggcg       780
     cgggactatg cccgtttcgg ggaattgctg cgcaaccatg ggcgcggcgc ggcggggcac       840
     cagatcgtgc cggaaaaatg gatcgaccat atgcgcgagc cttcgccccg caatgccgcc       900
     tatggggcgc atctgtggct gaaccgggac agcgaggaca gcgcgctgat gccgggacgg       960
     gcgccgcgca gcctgttcgg ctgcgtcggc catggcgggc aatatatact ggtttcgccc      1020
     tcgcagcgcc tgacggtcgt gcggctgggc atgtcgcccc gcaaggagga gcgcgccgcg      1080
     ctgaaggcgg aactggcgaa gctcgtcggg ctttatgcgc ggtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page