(data stored in ACNUC7421 zone)

EMBL: AP010803.PE171

AP010803.PE171       Location/Qualifiers
FT   CDS_pept        complement(179033..180811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01710"
FT                   /product="TrkA domain protein"
FT                   /note="sodium/sulfate symporter / di- and tricarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95005"
FT                   /db_xref="GOA:D4YXC3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC3"
FT                   /protein_id="BAI95005.1"
FT                   /translation="MHFITALIGIYRAEIGLVILALMFVAFVRERYSPTVVSVVGACAF
FT                   ALLGLLDEKDLFSVFSNSAPLTVGAMFVLSGALIRTGTINRVADLVMARAQRHPRLALA
FT                   EVTLGTVVLSAFLNNTPVVILLIPIMFKLAQATGYPVKKLLIPMNAVAVMGGCVTLIGT
FT                   STNLIVAGIAADQGMAPFGIFDITPYGLAGVAAGIAALAGLSFLLPSDPPSIAGEDGGN
FT                   VQDYLTELILSRDSDLIGRTVGSLSIFGRSASLLGLKRAGEIRRRGIEEEELHAGDHLL
FT                   VHADGATIMTLRESGDFEIGLAAASETPGGGTVIEAMIAPSHPSIGERLIDIPFLHALR
FT                   VRIIGIHRARHLPGPDLSETRVRGADRLLIAGSDDSIRSLKDNAHLIGVDISRARAFRP
FT                   RKAWIAILALTAVVLLSAIDVIGIGLAAFIAVGVILVTRCIDPEEAWAAIDGDVLILIF
FT                   AMLAVGLALEQAGSVALMVGWIDPLLAAAPAWSLVFLIYFFALLLSELLSNNAVAALLT
FT                   PLTIALAHQLGADPRPLVIALMIGASACFATPIGYQTNALVYAAGDYRFSDFVRIGIPL
FT                   NLVVGLAVCTALVLLG"
     atgcatttca tcaccgcgct gatcggcatc tatcgcgcgg agatcgggct tgtcatcctc        60
     gccctgatgt tcgtcgcctt cgtgcgcgaa cgctattcgc ccactgtcgt gtcggtggtc       120
     ggggcctgcg ccttcgcgct gctgggcctg ctcgacgaaa aggatctgtt ctccgtcttc       180
     tccaacagcg cgccgctgac ggtcggggcg atgttcgtgc tttccggcgc gctgatccgc       240
     acggggacga tcaaccgcgt cgccgacctg gtcatggccc gcgcccagcg acacccccgc       300
     ctggcgctgg ccgaagtcac gctcggcacg gtcgtccttt cggccttcct caacaacacg       360
     ccggtcgtga tcctgctgat cccgatcatg ttcaagctgg cgcaggcgac cggctatccg       420
     gtcaagaaac tgctgatccc gatgaacgcc gtcgcggtga tgggcggttg cgtgacgctg       480
     atcggcacat cgaccaacct gatcgtcgcg ggcatcgccg ccgaccaggg catggcgccc       540
     ttcggcatat tcgacatcac gccctatggg ttggccgggg tcgcggccgg catcgccgcg       600
     ctggccggcc tgtccttcct gctgcccagc gatccgccct ccatcgcggg ggaggatggc       660
     ggcaatgtgc aggattatct gaccgaactc atcctgtcgc gggacagcga cctgatcggt       720
     cgcaccgtcg gctccctgtc gatcttcggc cgctccgcca gcctgctcgg cctcaagcgg       780
     gcgggggaga tacggcgccg ggggatagag gaagaggaac tgcacgccgg cgaccacctg       840
     ctggtccatg ccgacggcgc gacgatcatg accctgcgcg aatccggcga cttcgaaatc       900
     ggcctggccg cggcgtcgga aactcccggc ggcggcaccg tcatcgaagc gatgatcgcg       960
     cccagccatc cgtccatcgg ggaacggctg atcgacattc ccttcctcca cgcgctgcgg      1020
     gtgcggatca tcggcattca ccgggcgcgc cacctgcccg gacccgacct cagcgaaacc      1080
     cgcgtgcgcg gcgcggaccg cctgctgatc gcgggcagcg acgacagcat ccgctcgctc      1140
     aaggacaatg cccatctgat cggcgtcgac atcagccgcg cccgcgcctt ccgcccgcga      1200
     aaggcgtgga tcgccattct cgccctgacg gcggtggtgc tgctttcggc catcgacgtc      1260
     atcggcatcg ggctggccgc cttcatcgcg gtgggcgtga tcctcgtcac ccgctgcatc      1320
     gatccggagg aggcatgggc cgcgatcgac ggcgacgtgc tgatcctcat cttcgcgatg      1380
     cttgcggtgg gactggcgct cgaacaggcg ggcagcgtcg cgctgatggt cggctggatc      1440
     gatccgttgc tcgccgccgc gcccgcatgg tcgctggtgt tcctcatcta tttcttcgcg      1500
     ctgctcctgt ccgaactgct cagcaacaat gcggtcgcgg cgctcctcac gccgctcacc      1560
     atcgcgctcg cccatcagtt aggcgccgat ccgcgcccgc ttgtgatcgc gctgatgatc      1620
     ggcgcgtcgg cctgcttcgc cacgccgatc ggctatcaga ccaatgcgct ggtctatgcg      1680
     gcgggcgatt atcgcttttc cgatttcgtg cggatcggga ttccgctcaa cctcgtcgtc      1740
     gggctggcgg tctgcaccgc gctcgtcctg ctgggatga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page