(data stored in ACNUC7421 zone)

EMBL: AP010803.PE175

AP010803.PE175       Location/Qualifiers
FT   CDS_pept        complement(183162..184133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01750"
FT                   /product="putative ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95009"
FT                   /db_xref="GOA:D4YXC7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC7"
FT                   /protein_id="BAI95009.1"
FT                   /translation="MPHPSPLSPESRRKHIAEEARTKFHRQIARVRPGSHAFEIAKRVA
FT                   VGTYNDGFIHAGNLAYLSLMTLFPFFIVAAAVASIFGRSQDGLAAVGAFLETVPPGVAE
FT                   VVRQPIVDVLNARTGPLLWLGGLVGLWTVGSLIETIRDILRRAYGTRSTRPFWHYRLTA
FT                   IGITLVSVFAVMFAFSMQVIITGIDQFLHQILPFADQAIQIVSLTKLAPMAILCVALYY
FT                   LYVSLTPSLYKDPRFPKWPGAIATALWWYGVTLLLPVTLSMLGGYDMTYGSLAGVMITL
FT                   IFFFLVGLGVVIGAELNAALAEFPEEEAAAAAQVDKGNGTTV"
     atgccgcatc catcccccct gtcgccggaa tcccgccgca agcatatcgc tgaagaagcc        60
     cgcaccaagt tccaccgcca gatcgcccgc gtgcggcccg gcagccacgc gttcgaaatc       120
     gcgaagcggg tggcggtcgg cacctataat gacggcttca tccatgccgg gaaccttgcc       180
     tatctctcgc tgatgacgct gttccccttc ttcatcgtgg cggcggcggt ggccagcatc       240
     ttcggtcggt cgcaggacgg gctggcggcg gtcggcgcct ttctggaaac ggtgccgccc       300
     ggcgtcgcgg aggtggtgcg ccagcccatc gtcgacgtgc tgaacgcccg cacggggccg       360
     ctgctctggc tgggcgggct ggtggggctg tggaccgtcg gcagcctcat agagacgatc       420
     cgcgacatat tgcgccgcgc ctatgggacc aggagcacgc gccccttctg gcactatcgc       480
     ctgaccgcca tcggcatcac gctggtcagc gtgttcgcgg tgatgttcgc cttctccatg       540
     caggtgatca tcaccggcat cgaccagttc ctgcaccaga tcctgccctt tgccgaccag       600
     gcgatacaga ttgtcagcct gacgaagctg gcgcccatgg cgatcctgtg cgtcgcgctt       660
     tattatctct acgtttccct gacccccagc ctgtacaagg atccgcgctt cccgaaatgg       720
     cccggcgcca tcgccacggc gctctggtgg tatggcgtca ccctgctgct gccggtcacg       780
     ctttccatgc tcggcggcta tgacatgacc tatggcagcc tggccggggt gatgatcacg       840
     ctcattttct tctttcttgt cgggcttggc gtggtaattg gcgcggaatt gaatgcggcg       900
     ctggcggagt tcccggaaga ggaggccgcg gccgccgcgc aggtcgataa agggaatggg       960
     acgacggtat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page