(data stored in ACNUC7421 zone)

EMBL: AP010803.PE182

AP010803.PE182       Location/Qualifiers
FT   CDS_pept        190052..190483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95016"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD4"
FT                   /protein_id="BAI95016.1"
FT                   /translation="MAKADQIEVGLRIIIEQPVIGVLHSLQAKDDRPLDPKASGTGEPL
FT                   SFDLPIRIAPGPRFFGDQVRREGPVRRFIYIRIGQLAGDPPSPWSRRMKIDIHDLDEDL
FT                   LTRAIEGRGIIEIVVNGTGKDGTPACATVPPVCRRLSES"
     atggcgaaag cggatcagat cgaagtcgga ttgcggatca tcatcgagca gccggtcatc        60
     ggcgtgctgc acagccttca ggccaaggat gaccggccgc tcgatccgaa agcgtccggc       120
     accggcgagc cattgtcgtt cgacctgccg atccgcatcg cgccggggcc cagatttttc       180
     ggcgatcagg tccgccgcga agggccggtg cggcgcttca tctatattcg gatcggccag       240
     ttggccggcg atccgccgtc gccatggtcg cgccggatga agatcgacat tcacgatctg       300
     gacgaagacc tgctgacgcg ggccatcgaa ggacggggta tcatcgaaat cgtcgtgaac       360
     ggcacgggca aggacggaac gcccgcctgc gccaccgtgc cgccggtctg ccgccgcctc       420
     agcgaaagtt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page