(data stored in ACNUC7421 zone)

EMBL: AP010803.PE186

AP010803.PE186       Location/Qualifiers
FT   CDS_pept        194700..195389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01860"
FT                   /product="extensin-like protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95020"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD8"
FT                   /protein_id="BAI95020.1"
FT                   /translation="MIERVWGNAILRGTGLAALTAAVLAGCGGDLVPRGRVERPAKPVR
FT                   TARPAAPPPMELRQCMAKLTSQSVLFTPLPDQNFGGGCSATGSVKLIDIGVPATNLGAM
FT                   TCGLAANFAAWARYGVQPAARLILGAEVERIETFGTYNCRPIAGSGKLSEHAHSNAVDV
FT                   SAFVLSDGRRISIQNDWNGDRRVRQFLEIIHASACKRFRTVLSPDYNAAHHDHFHFDMG
FT                   GRGGFCR"
     atgatcgagc gggtttgggg gaatgcgatc cttcgcggca cgggtcttgc ggccctgacg        60
     gcggccgtgc tggcgggctg cggcggcgac ctggtgccgc gcgggcgcgt ggagcgaccc       120
     gccaagccgg tccggaccgc ccgccccgcc gcgccgccgc cgatggaact tcgccagtgc       180
     atggcgaagc tgacgtccca gtcggtcctc ttcacccccc tgcccgacca gaatttcggc       240
     ggcggatgca gcgcgacggg cagcgtcaag ctgatcgaca tcggcgtgcc cgcgaccaat       300
     ctgggcgcga tgacatgcgg cctggccgcc aatttcgcgg cctgggcgcg ctatggcgtg       360
     cagcccgccg cccggctgat cctgggggca gaggtcgagc ggatcgaaac cttcggcacc       420
     tataattgcc ggcccatcgc gggcagcggc aaattgtccg aacatgcgca cagcaatgcg       480
     gtcgacgtgt ccgccttcgt gctgagcgac gggcggcgca tcagcatcca gaacgactgg       540
     aacggcgacc ggcgggtccg gcagtttctg gagatcatcc acgccagcgc ctgcaagcgg       600
     ttccgcaccg tgctcagccc cgattacaac gccgcgcatc acgaccattt ccatttcgac       660
     atgggcggcc gcggcggctt ttgccgctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page