(data stored in ACNUC7421 zone)

EMBL: AP010803.PE187

AP010803.PE187       Location/Qualifiers
FT   CDS_pept        195466..196344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01870"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="putative Rossmann fold nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95021"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD9"
FT                   /protein_id="BAI95021.1"
FT                   /translation="MTRKEIEERKFRPASQEAADARLRTETPQTSSAAYRLAFQDTEFL
FT                   LREDLRPVRFQLELLKPQLLMDEAKIESTFVFYGSARIPEPEQVQARIDAATTPEQKRI
FT                   AENLGRKARYYEEARKLARISAQYPVNEAGCRHFVVCSGGGPSIMEAANRGAADVGQTT
FT                   IGMNIVLPHEQSPNRFVTPELSFQFHYFALRKMHFLLRARALAVFPGGFGTFDEMFELL
FT                   TLIQTGKMKPIPVLLFGREFWTRVVDFEALADEGVISPSDLNLLTWVETAEDAWEAVQR
FT                   FYEDSEAPGCG"
     atgactagaa aagaaatcga agaacgcaaa ttccgccccg ccagccagga agcagccgac        60
     gcccggctga ggacggaaac cccccagacc agcagcgccg cctaccgact ggccttccag       120
     gacacggaat tcctgctgcg ggaggatctg cggccggtgc ggttccagtt ggaactgctg       180
     aaaccccaat tgctgatgga cgaggcgaag atcgagtcca ccttcgtctt ctacggttcg       240
     gcgcggattc ccgaaccgga gcaggtgcag gcgcggatcg acgccgcgac cacgccggaa       300
     cagaagcgca tcgccgaaaa tctgggcagg aaggcgcgct attatgagga agcgcgcaag       360
     ctggcgcgga tttcagcgca atatccggtg aatgaggcgg gatgccgcca tttcgtcgtc       420
     tgttcgggcg gcggcccatc gatcatggag gcggccaatc gcggcgcggc ggatgtcggc       480
     cagaccacca tcggcatgaa catcgtcctg ccgcatgaac aatcgcccaa ccgcttcgtc       540
     acgccggaac tgagcttcca gttccactat ttcgcgctgc gcaagatgca tttcctgctg       600
     cgcgcgcggg cgctggcggt gtttccgggc gggttcggca cgttcgacga gatgttcgaa       660
     ctgctgacgc tgatccagac cggcaagatg aagccgatcc cggtgctgct gttcgggcgg       720
     gaattctgga cgcgggtggt ggatttcgag gcgctggcgg acgaaggcgt aatctctccg       780
     tccgacctca acctgctgac ctgggtggag accgccgagg atgcgtggga ggcggtgcag       840
     agattctatg aggattcgga agcgccgggg tgcgggtaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page