(data stored in ACNUC7421 zone)

EMBL: AP010803.PE188

AP010803.PE188       Location/Qualifiers
FT   CDS_pept        196406..196831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95022"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE0"
FT                   /protein_id="BAI95022.1"
FT                   /translation="MGSGPTPFLPIERWGGGPREAWWRGMGHDLRISPSTTRFASGPPP
FT                   HASRREELTSAIGHPKTFPSRKREGLGVGATPDLIRGSFWLGPLQNNADVAPAHPLTPS
FT                   RLREGERPLPTHAVRRLSTSLETSRGQVTFATTHGMS"
     gtggggagcg gacctacccc attcctcccc atcgaaagat ggggaggggg accgcgcgaa        60
     gcgtggtgga ggggaatggg gcacgacctg cgtatttccc cctccaccac tcgcttcgcg       120
     agcggtcccc ctccccacgc ttcgcgtagg gaggaattaa cgtcggctat tggccatccc       180
     aagacattcc cctcccgtaa acgggagggg ttaggggtgg gcgcgacccc ggacttgatc       240
     cgggggagct tctggcttgg cccgttgcaa aacaacgcgg atgttgcgcc agcccacccc       300
     ctaaccccct cccgcttgcg ggagggggaa cgtccgcttc ccacccacgc cgtccgccgt       360
     ctctcgactt cgctcgaaac aagccgaggt caggtgactt tcgccaccac acacggcatg       420
     tcctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page