(data stored in ACNUC7421 zone)

EMBL: AP010803.PE192

AP010803.PE192       Location/Qualifiers
FT   CDS_pept        complement(200003..200581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01920"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95026"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE4"
FT                   /protein_id="BAI95026.1"
FT                   /translation="MMNMLTDSHDAVTADWAAALLDFWFNQVGEQGWWSHDPALDRTCQ
FT                   ARFRALWEEKRHLPAEEFLERADDALAAVLLFDQLPRNMFRGSAAAFSTDALARDVARG
FT                   AVAHGYDIQIGGAGRLFFYMPFQHSEALDDQKLSVSLFEGAGDAKSLAFAREHYAVIER
FT                   FGRFPHRNAALGRANAPGEEEAAEEGGGW"
     atgatgaaca tgctgaccga cagccatgac gccgtgaccg ccgactgggc ggcggccctg        60
     ctggatttct ggttcaacca ggtcggcgag cagggatggt ggagccacga tccggcgctc       120
     gaccggacgt gccaggcgcg attccgcgcc ctgtgggaag aaaagcgcca tctgcccgcc       180
     gaggaatttc tggagcgggc cgacgacgcg ctggcggcgg tcctgctgtt cgaccagttg       240
     ccgcgcaaca tgtttcgggg atcggccgcg gctttctcca ccgatgcgct ggcccgcgac       300
     gtcgcgcgag gggcagtggc ccatggctat gacatccaga tcggtggcgc cgggcggctg       360
     ttcttctaca tgcccttcca gcatagcgag gcgctggacg atcagaaatt gtcggtcagc       420
     ctgttcgaag gcgcgggcga cgcgaagtcc ctggcgttcg ctcgggagca ttatgcggtg       480
     atagagcggt tcggccgctt tcctcatcgc aacgccgcgc tgggccgcgc aaatgcgccg       540
     ggagaagaag aggcggcgga ggaaggtggg ggttggtga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page