(data stored in ACNUC7421 zone)

EMBL: AP010803.PE195

AP010803.PE195       Location/Qualifiers
FT   CDS_pept        complement(202514..202687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95029"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE7"
FT                   /protein_id="BAI95029.1"
FT                   /translation="MALTLLLAGTVAPFLLMFSPVSLATARDCLDWEAPAKAVDLGVEK
FT                   PCPKKKPPLLLM"
     atggctctca cgcttcttct tgccgggacg gtggcgccct ttctgctgat gttttcgccg        60
     gtttcgctgg cgacggcccg cgattgcctg gattgggagg cgccggccaa ggcggtcgac       120
     ctgggcgtgg agaagccctg tccgaaaaag aagccgccgc tgctgctgat gtaa             174
//

If you have problems or comments...

PBIL Back to PBIL home page