(data stored in ACNUC7421 zone)

EMBL: AP010803.PE198

AP010803.PE198       Location/Qualifiers
FT   CDS_pept        complement(205253..206767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SJA_C1-01980"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95032"
FT                   /db_xref="GOA:D4YXF0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF0"
FT                   /protein_id="BAI95032.1"
FT                   /translation="MTLAPRLDLRQSQSLVMTPQLQQAIKLLALSNLEIEAFVAGELEK
FT                   NPLLEAGGTDDFAPPADGVDRAAEQHDLRAETGDADQLIGQGLGAADSPLDVDYGAETF
FT                   IDDGPGDRMAGAIGSGGGMDMLSGGSGEAPDFDSFANPEQGLQEHLMDQARSALSGMDL
FT                   MIAAQLIGQIDEAGYLEANLLETAHGMGVPLYRIEQVLGVIHGFDPTGVGARSLSECLA
FT                   LQAKEADRYDPCMAKLLANLDLLARGALPQLRRICGVDEEDMADMIRELRGYDPKPGLR
FT                   FSSESAAPVTPDLFVRPTREGWAIEVNSATLPRVLINRTYYVELASGPQDRTSKAWLAD
FT                   CLASANWLVKALDQRQKTIVKVASEIVRQQEDFFRKGVEHLKPLTLKAVADAIQMHEST
FT                   VSRVTSNKYLSCPRGLYELKYFFTSGVAAAGGEGAVSAEAVKSHIKALIAAETADAILS
FT                   DDTLVDLLRAKGMDIARRTVAKYREAMGIGSSVQRRRQKALRGQAA"
     atgacgctcg cgccccgtct cgacctgcgg cagagccagt cgctggtgat gacgccgcag        60
     ttgcagcagg cgatcaagct gctggcgctg tccaatctgg agatcgaggc gttcgtcgcg       120
     ggcgaactgg aaaagaatcc gctgctggag gcgggcggga cggatgattt cgcgccgccc       180
     gccgacgggg tggaccgggc ggcggagcag catgacctgc gcgccgaaac gggcgatgcg       240
     gaccagttga tcggccaggg actgggcgct gccgattccc cgctggacgt cgattatggc       300
     gcggagacct tcatcgacga tgggccgggc gaccggatgg cgggcgccat cggctccggc       360
     ggcgggatgg acatgctgtc gggcggcagc ggcgaggcgc cggacttcga cagcttcgcc       420
     aatccggaac aggggcttca ggaacatctg atggatcagg cgcgcagcgc gctgtcgggc       480
     atggacctga tgatcgccgc gcaactgatc gggcagatcg acgaggccgg ttatctggag       540
     gccaatctgc tggagaccgc ccatggcatg ggcgtgccgc tttacaggat cgagcaggtg       600
     ttgggcgtga tccacggttt cgacccgacc ggggtggggg cgcggtcgct gtcggaatgc       660
     ctagccttgc aggcgaagga ggcggatcgt tacgacccct gcatggcgaa gctgctggcc       720
     aatctggacc tgctcgccag gggggcgctg ccgcagttgc gccggatctg cggcgtggac       780
     gaggaggata tggcggacat gatccgcgaa ttgcgcggtt acgatcccaa gcccggcctg       840
     cgcttttcct ccgagagcgc cgcgccggtg acgcccgacc tgttcgtgcg gccgacgcgg       900
     gagggttggg cgatcgaggt caacagcgcc accctgcccc gcgtgctgat caaccggacc       960
     tattatgtcg aactcgcctc cgggccgcag gacaggacgt ccaaggcgtg gctggccgat      1020
     tgcctggcga gcgccaactg gctggtgaag gcgctggacc agcggcagaa gaccatcgtc      1080
     aaggtcgcga gcgagatcgt ccgccagcag gaggatttct tccgcaaggg ggtggagcat      1140
     ctgaagccgc tgacgctgaa ggccgtggcc gacgcgatcc agatgcatga atcgaccgta      1200
     agccgggtga cgtcgaacaa atatctgtcc tgcccgcgtg ggctgtatga actcaaatat      1260
     ttcttcacca gcggcgtggc ggcggcgggc ggcgagggcg cggtgtcggc cgaggcggtc      1320
     aagagccaca tcaaggcgct gatcgcggcg gagacggccg acgccatatt gtcggacgac      1380
     acgctggtcg acctgctgcg cgccaagggc atggacatcg cccgccgcac cgtcgccaaa      1440
     tatcgcgagg cgatggggat cggatcgtcg gtgcagcggc ggcggcagaa ggccttgcgg      1500
     gggcaggcgg cttag                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page