(data stored in ACNUC7421 zone)

EMBL: AP010803.PE2

AP010803.PE2         Location/Qualifiers
FT   CDS_pept        980..1573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00020"
FT                   /product="Maf-like protein"
FT                   /note="nucleotide-binding protein implicated in inhibition
FT                   of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94836"
FT                   /db_xref="GOA:D4YWV4"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV4"
FT                   /protein_id="BAI94836.1"
FT                   /translation="MIVLASQSASRRALLEAAQVPFEALSPGVDEEAAKEALRADGLDA
FT                   RQLADALAELKALRVSRRVPGALVLGCDQTLSLDDGAMIDKAVDRSDAERILKLLSGRV
FT                   HHLHSAAVIALNGEPIWRHIERVRMTVRPLSDAFIAHYLDGDWEQCRWCVGCYRIEGPG
FT                   AQLFSRVEGSQFAIQGLPLLPLLDFLRIRGVLES"
     atgatcgtgc tggcgtcgca aagcgcgagc cgccgggcgc tgctggaagc ggcgcaagtg        60
     ccgttcgagg cgctctcgcc cggcgtcgac gaggaagcgg ccaaggaagc cctgcgcgcc       120
     gacgggctgg acgcccggca actggccgat gcgctggcgg aactcaaggc gctgcgcgtg       180
     tcgcgccggg tgccgggcgc gctggtgctg ggctgcgacc agacgctcag cctggacgac       240
     ggcgccatga tcgacaaggc ggtcgaccgc agcgatgccg agcggatatt gaagctgctt       300
     tccgggcggg tccatcatct ccacagcgcg gcggtgatcg cgcttaacgg tgaaccgatc       360
     tggcggcata tagagcgagt gcggatgacg gtgcgcccct tgtccgacgc tttcatcgcg       420
     cactatctcg acggcgactg ggagcaatgc cgctggtgcg tcggctgcta ccggatagag       480
     ggaccgggcg cgcagctttt cagccgggtc gaaggcagcc agttcgcgat tcagggcctg       540
     ccgctgctgc ccctgcttga ctttctgcgc atccggggcg ttctggagtc atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page