(data stored in ACNUC7421 zone)

EMBL: AP010803.PE200

AP010803.PE200       Location/Qualifiers
FT   CDS_pept        207644..207907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95034"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF2"
FT                   /protein_id="BAI95034.1"
FT                   /translation="MTPRGNWQALCMGTPPGQGENGVSDLFGAMIRDKIGVGAGAFNAR
FT                   PTGNKEGNAGAPNGEGLFRSEEMVRSRGTNSVFQHVSRKCRH"
     atgaccccgc gcggcaattg gcaagctttg tgcatgggaa cgccgccggg gcaaggggaa        60
     aatggtgttt cggacctttt tggggccatg atccgcgaca agattggtgt tggcgcaggt       120
     gctttcaatg cacgtccgac agggaacaaa gagggaaatg ccggggcgcc caacggcgaa       180
     ggcctgttcc ggtcggaaga aatggtgcgg tcgagaggca cgaattcggt gttccaacat       240
     gtatcaagga aatgccggca ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page