(data stored in ACNUC7421 zone)

EMBL: AP010803.PE201

AP010803.PE201       Location/Qualifiers
FT   CDS_pept        complement(207959..210058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02010"
FT                   /product="alcohol dehydrogenase large subunit"
FT                   /EC_number="1.1.2.-"
FT                   /note="uncharacterized proteins of WD40-like repeat family
FT                   / glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95035"
FT                   /db_xref="GOA:D4YXF3"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF3"
FT                   /protein_id="BAI95035.1"
FT                   /translation="MNRIIRIIILTGAGAPLLAATVAGVHPGAVDDARMIAAASEPANW
FT                   LVNGGTFNGDHYSKLDQINVNTVKDLKPAWSFDFDTVRGQQSEPLVVDGVMYVSTSWSK
FT                   VYALDAATGRQIWFFDPMVPGDTGVKVCCDTVNRGVAVYKGKVYVGTLDGRLIAISART
FT                   GTQLWSTRTVDPKSALTITGAPRVIHDKVIIGNAGADFGVRGYVSAYDAATGKLVWRFY
FT                   TVPGDPAKGPDHAASDEIMEKLVRPTWSGDYAKYGGGGTAWHAISYDPELNQLYIGTGN
FT                   GSPWNPKYRTAGKGDNLFLCSVIALDPDTGKYIWHYQENPQEAWDYNSSQPMILGNLTI
FT                   DGKIRKVLMHAPKNGFFYVLDRTNGKVISAKPYVPVTWASGIDTVTGRPIETPNSRYTD
FT                   GPFHLRPNSSGAHNWHAMAYSPKTGLVYLNAFENSAEVRDDPNFKTYTRGPFNTGLLSK
FT                   LKGGPTHLLAWNPVTQTEAWRVPADRAGVLATAGGLVFQGQGAVTGRFTAFRADNGREV
FT                   WNYKMPNGVQAGPIAYSVRGVQYVAIATGNGASPAAGDADERERQPGRMVAFRLNGTAK
FT                   LPAEPGAPPPPNPTADPFTDKQIAQGGTNYGRYCSRCHGPAAISSNVIPDLRRSAFLSD
FT                   RQSWRAVVIDGALEGNGMVGWKQHLDEAEAEEIRGYVSAQAVALKKRGSGAATSRPPES
FT                   ASPEQ"
     atgaatcgca taattcggat cattatctta accggcgccg gtgcgcccct gcttgccgcg        60
     acggtggcag gtgtccaccc cggcgccgtc gacgatgccc ggatgatcgc cgccgcctcc       120
     gaaccggcga attggctggt caatggcggc accttcaacg gcgaccatta ttcgaagctc       180
     gatcagatca acgtcaacac ggtcaaggac ctgaagcccg cctggagctt cgacttcgac       240
     acggtccggg ggcagcaatc cgagccgctg gtggtcgacg gggtgatgta tgtctccacg       300
     tcgtggagca aggtctacgc gctcgacgcg gccaccgggc gacagatatg gttcttcgat       360
     ccgatggtgc cgggcgacac gggggtgaag gtctgctgcg acacggtcaa tcgcggcgtc       420
     gcagtctaca agggcaaggt ttatgtcggc acgctcgacg ggcggctgat cgcgatcagc       480
     gcgcgcaccg gcacccagct ttggagcacc cggacggtcg atccgaagag cgcgctcacg       540
     atcaccggcg cgccgcgcgt gatccatgac aaggtcatca tcggcaacgc cggcgccgat       600
     ttcggggtgc ggggctatgt ctcggcctat gacgcggcca cgggcaagtt ggtgtggcgc       660
     ttctacaccg tgcccggcga tcccgcgaag gggccggacc acgccgcatc ggacgagatc       720
     atggagaagc tggtgcgccc gacctggtcc ggcgactatg ccaaatatgg cggcggcggc       780
     acggcctggc acgcgatctc gtacgatccg gaactgaacc agctctacat cggcaccggc       840
     aacggctcgc cctggaatcc gaaataccgc accgccggca agggcgacaa tctgttcctc       900
     tgctcggtga tcgcgctcga ccccgacacc ggcaaatata tctggcacta tcaggagaat       960
     ccgcaggagg cctgggatta taattcctcc cagccgatga tcctgggaaa cctgaccatc      1020
     gacggcaaga tccgcaaggt gttgatgcat gcgccgaaga acgggttttt ctatgtgctg      1080
     gaccgcacca acgggaaggt gatctcggcc aagccctatg tcccggtgac ttgggcatcg      1140
     ggcatcgaca cggtgaccgg ccgcccgatc gagacaccca attcccgcta taccgatgga      1200
     ccgttccacc tgcggcccaa cagctccggc gcgcataact ggcatgccat ggcctacagc      1260
     ccaaagaccg gcctcgtcta tctcaacgct tttgaaaaca gcgcggaggt acgtgacgat      1320
     cccaatttca agacctatac gcgcggcccc ttcaacaccg gcctgctgag caagctcaag      1380
     ggcggcccga cccatctgct cgcctggaat ccggtgaccc agaccgaggc gtggcgcgtg      1440
     ccggcggacc gcgcgggcgt gctggcgacg gcgggcggat tggtgttcca gggccagggc      1500
     gccgtgaccg gccgcttcac cgctttccgc gccgataatg gacgggaggt ctggaactac      1560
     aagatgccca acggcgtcca ggcggggccc atcgcctaca gcgtccgcgg cgtgcaatat      1620
     gtcgcgatag ctactggtaa cggcgccagc cccgcggccg gcgacgccga cgaacgcgaa      1680
     cgccagccgg gccggatggt cgccttccgc ctgaacggca cggccaagct tcccgccgaa      1740
     cccggcgcgc cgccgccgcc caatccaacc gcggacccat tcaccgacaa gcagatcgcc      1800
     caaggcggaa cgaattacgg caggtactgt tcgcgctgcc acggcccggc agcgatatcc      1860
     tcgaacgtca ttcccgatct gcgccgctca gctttcctct ccgaccggca atcctggcgc      1920
     gctgtggtga tcgacggcgc gctggagggc aacggcatgg tgggctggaa gcagcatctc      1980
     gacgaggcgg aggcagagga aatccggggc tatgtgtccg ctcaggcggt cgcgctgaaa      2040
     aagcgtggat caggtgccgc aacatcaagg ccgccggaat ccgcttcccc tgagcaatag      2100
//

If you have problems or comments...

PBIL Back to PBIL home page