(data stored in ACNUC7421 zone)

EMBL: AP010803.PE202

AP010803.PE202       Location/Qualifiers
FT   CDS_pept        complement(210147..210668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95036"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF4"
FT                   /protein_id="BAI95036.1"
FT                   /translation="MSAEAIHLLIAAETPPPAAGETALTGRARVGGGRGEGAPVTRMLL
FT                   SPHPIAAPPVEGEIRWSGARVARVGLVEIANATALLCNFLEVADEAEEEFNAWYDTEHL
FT                   PRLGALPGVSGIARYRSDASPRYLALFTLAGSDIPAGEAWRTAARTPWTARIKRFTRGY
FT                   HSFLFTPASL"
     ttgagcgccg aggcgattca tctgctgatc gcggcggaga cgcccccgcc cgccgctggc        60
     gagacggcgt tgacaggccg ggcgcgggtc ggcggcggga gaggcgaggg cgcgccagtc       120
     acgcgcatgc tgctctcccc ccatccgatc gccgcgcccc ccgtcgaagg cgagatacgg       180
     tggagtggcg cgcgcgtcgc ccgtgtcggc cttgtcgaga ttgcgaacgc cacggcgctc       240
     ctctgcaact tcctcgaagt cgcggacgag gcggaggagg aattcaacgc ctggtacgac       300
     accgagcatc tgccgcgcct gggcgcgctg ccgggcgtga gcgggatcgc gcgctatcgg       360
     tccgacgcgt cgccgcgcta tctggcgcta ttcacgctcg ccggatccga cattccggcc       420
     ggcgaggctt ggcgcaccgc cgcccgaaca ccctggacgg cgcggatcaa gcgcttcacc       480
     cgcggctatc acagcttcct cttcacgccc gcctcgctgt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page