(data stored in ACNUC7421 zone)

EMBL: AP010803.PE208

AP010803.PE208       Location/Qualifiers
FT   CDS_pept        217367..217792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02080"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /note="Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95042"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG0"
FT                   /protein_id="BAI95042.1"
FT                   /translation="MTDSTPLSEFRPVRSGLMTGALDDLASVGLAGSRCRACGETTLGA
FT                   NTLCPNCGSDDVFPIALSDEGKVWTYTVVRYRPPGDYKGAEPFQPFAIGLVELPEGLRV
FT                   VAPVGGDPDAVRIGMTVRFTARARADGVVDFVYNPAA"
     atgactgatt ccacaccgct ctcggaattc cgcccggtgc ggagcggcct gatgactgga        60
     gcgctggacg acctcgcctc ggtcggcttg gccggaagcc gctgccgggc ctgtggagag       120
     acgaccctcg gcgccaacac gctctgtccg aattgcggca gcgacgatgt cttcccgatc       180
     gcgctctccg acgagggcaa ggtgtggacc tataccgtgg tgcgctatcg cccgccgggc       240
     gattacaagg gcgcggaacc gttccagccc ttcgcgatcg ggctggtcga actgcccgaa       300
     gggctgcgcg tcgtggcgcc cgtgggcggc gatccggatg ctgtgcgcat cggcatgacg       360
     gtgcggttca cggcccgcgc gcgcgccgat ggcgtcgtcg atttcgtcta caatcctgcc       420
     gcctaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page