(data stored in ACNUC7421 zone)

EMBL: AP010803.PE212

AP010803.PE212       Location/Qualifiers
FT   CDS_pept        complement(221835..222623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02120"
FT                   /product="conserved hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95046"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG4"
FT                   /protein_id="BAI95046.1"
FT                   /translation="MGVNNMRHGMERRTLIGGALATGLAGALPGRLLAAAPDGRLFKCT
FT                   EFLRRAPGMTPDAFLAHWEKERAPLLLGLKGLRGLIFNRVIRERSPDAPHDGIIEMWFA
FT                   DEAAYTHAFGAADEQLIGALADDLPHFAAGDPMGLFTREVSIRIPNSKPGNAKRIGLVG
FT                   RNPGTTEDQFFREWRTVHAKEAANQPGLAGYVLNMRAGPRLPDLPWDGYAQLWWTDWPA
FT                   FEAASRAIHATVGARLHFFHAHQLYYVDEFVALALQGRFG"
     gtgggcgtga acaacatgcg gcatgggatg gagcgtcgga cgctgatcgg cggcgcgctg        60
     gcgacgggac tggcgggcgc cttgcccggc cgcctcctgg ccgccgcgcc cgatggccgt       120
     ctgttcaaat gcacggaatt cctccggcgc gcgcccggaa tgacgccgga cgccttcctc       180
     gcccattggg agaaggaacg cgcgccgctt ctgctcggac tgaagggttt gcgcggcctc       240
     attttcaaca gggtgatccg cgaacgatcg ccggacgccc cgcatgacgg catcatcgaa       300
     atgtggttcg cggacgaggc ggcgtacacc catgcctttg gcgctgcgga cgagcagctg       360
     atcggcgcgc tggcggacga cctgccgcac tttgcggcgg gcgatccgat ggggttgttc       420
     acgcgggaag tgtccatccg gattcccaac tccaaaccgg gcaacgccaa gcgcatcggg       480
     ctggtcggac ggaatcccgg cacgaccgag gaccagttct tccgggagtg gcggaccgtc       540
     cacgccaagg aagcggccaa tcagccggga ctcgccggct atgtgctgaa catgcgtgcg       600
     gggcctcgcc tgcccgatct gccctgggac ggctatgccc aattgtggtg gaccgactgg       660
     ccagcgttcg aggcggccag ccgggcgatc cacgccacgg taggcgcgcg gctccacttc       720
     ttccatgcgc accagcttta ttatgtcgac gagttcgtcg cgctggcgct ccaaggccgc       780
     ttcggctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page