(data stored in ACNUC7421 zone)

EMBL: AP010803.PE213

AP010803.PE213       Location/Qualifiers
FT   CDS_pept        complement(222775..223212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95047"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG5"
FT                   /protein_id="BAI95047.1"
FT                   /translation="MMDHSAATRNPHASRRAARDQRHDLQPAAPGRHEDMLASRTYNAA
FT                   HIGGCRSGGGEHRSRDGGAGAKRKNISPAQASNPWNTPEPHGQIRNIGEWPMASVNSSL
FT                   RAAWGGGPPLKAVVEGKIGRSCPFPSTSLRPAPSPSPDGED"
     atgatggacc atagcgcagc tacacgaaat cctcacgcgt cacgccgggc ggcgcgagat        60
     cagcgtcatg atcttcagcc tgcggcgcct gggcggcacg aagacatgct tgcgtcacga       120
     acatataatg ccgctcatat aggtgggtgc cgcagcggcg gcggagagca tcgaagtcgg       180
     gatggcggcg caggcgccaa gcgcaagaac atctcgcccg cacaagcttc caatccctgg       240
     aacactcctg agccgcatgg acaaattcgg aatatcggcg aatggccaat ggcgagcgtc       300
     aattcctccc tgcgcgcagc gtggggaggg ggaccgccgc tgaaagcggt ggtggagggg       360
     aaaatcggaa ggtcgtgccc cttcccctcc accagccttc ggccggcccc ctccccatct       420
     cccgatgggg aggattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page