(data stored in ACNUC7421 zone)

EMBL: AP010803.PE214

AP010803.PE214       Location/Qualifiers
FT   CDS_pept        223334..226138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02140"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95048"
FT                   /db_xref="GOA:D4YXG6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG6"
FT                   /protein_id="BAI95048.1"
FT                   /translation="MRYRLLTASVSAIGIASFLAAAAGAQTAPATAAAQDAAPDNPQDI
FT                   NAQDIVVTGSRVALSGFQAPSPTAVVGSEVIDRRAATTVMSVLNLNPAFKPTRSPGANA
FT                   TNTGSPAQATADLRSLGGQRTLVLVNGSRMVPSSPASKLGVPVTVDLNLIPTLMVDRVE
FT                   TVTGGASAQYGSDAVSGVVNVILKKHFTGLEARAQAGISEEGDYATQRLGFIAGTSFAQ
FT                   DRGHVVVSADYERNSGVGDMYTRDWGRKEYQIYSNSAYRTNGQPALILTQGVHNNLGAG
FT                   GRITGPAGFSLNKYTFNSDGSVRPFDSGTLSNGTTQIGGEGQSIARGTSLVPALRRFTT
FT                   YAHAEYEFGPALTAYVEGGYSRSKGILSGLPPRYTSVTIKDDNAYLSPAVKAAMAKDGI
FT                   TSFTMSRIGYDFGNVKTEAVNATRHVEVGGKGELGGSWHWDAHYSYGRNNYDGYSFNNT
FT                   ISANVPLAADAVFNSAGKIVCRSTRDVNPNNGCVPLNLFGAGSPSAAAINYVNGTGHTT
FT                   VKYIQHSAAANLRGNLFSTWAGPVSAAVGIEYRRESENVGADPIAAANGFSSTGNAVPY
FT                   RGSFDVKEAYVEAIVPLAKDKPFLRSLNINGAARFAHYSTVGDQVTWKVGGVWEPVDGL
FT                   RLRVTRSRDIRAPAIWELASPGNFVTNTITVNGITKIIPQNVSAGNPDLKAEKADTFTA
FT                   GVVVEPGGFLRGLRASVDYYDINLKGAITNLSGLNVASLCTLGQQEFCSLFTFDAAGNP
FT                   TSLTAPALNVGSFRNKGLDMTLSYGFPLGEGRVSIAASGTYVFNALVDPGTGAGAIERV
FT                   GEMGQANLGAMPRFRGNLAVTYTRGPFSITPQLNFISAGKQDNIYNTTPALTINDNHVP
FT                   AFAYLDLAGSIDATQQFRFFWSIENLLDKDPAPTPYAVLNVPTNGIWYDKVGRRFMAGV
FT                   RVRL"
     atgcggtatc gccttttgac tgcgtcggtg tccgccatcg gcatcgcgtc cttcctcgct        60
     gccgcggcgg gcgcgcagac cgcgcctgcg accgctgcag cgcaggatgc cgcccctgac       120
     aacccgcagg acatcaacgc gcaggacatc gtggtcactg gctcgcgcgt tgcgttgagc       180
     gggttccagg ccccgtcgcc gaccgccgtg gtcggctccg aagtgatcga tcgccgcgcg       240
     gccaccacgg tgatgtccgt gctgaacctc aacccggcct tcaagccgac gcgcagcccc       300
     ggcgccaacg cgaccaacac cggcagcccg gcccaggcga cggctgacct gcgctccctg       360
     ggcggacagc gcacgctggt gttggtgaat ggcagtcgca tggtgccgtc atcgcccgcc       420
     agcaagctcg gcgtgcccgt cacggtggac ctcaacctga tccccacgct gatggtcgat       480
     cgggtggaga cggtgacggg cggcgcatcc gcccaatatg gttcggacgc cgtgtccggc       540
     gttgtgaacg tcatcctgaa gaaacatttt accgggctcg aggcgcgcgc ccaggcgggc       600
     atatccgagg aaggcgacta tgcgacgcag cgtctgggtt tcatcgcggg caccagcttc       660
     gcgcaggatc gcggccatgt cgtcgtgagc gcggactatg agcgcaacag cggcgtcggc       720
     gacatgtaca cgcgcgactg gggccgcaag gaatatcaaa tctatagcaa ctccgcctac       780
     aggacgaacg gtcagccggc gctgatcctg acgcaggggg tgcacaataa tctgggcgcg       840
     ggcggcagga tcaccggccc ggccggcttc tcgctgaaca aatatacctt caattccgat       900
     ggcagcgtgc gaccgttcga ttccggcacc ctgtcaaacg ggacgacgca gatcggcggt       960
     gaaggacagt cgatcgcgcg cggcaccagt cttgtgcccg cgctgcgccg tttcaccact      1020
     tacgcgcacg ccgaatatga gttcggaccc gcccttaccg cctatgtgga gggcggctat      1080
     tcgcggtcga agggcatatt gagcgggctg ccgccgcgct acacctccgt gaccatcaag      1140
     gacgacaatg cgtatctgtc gccagccgtg aaggcggcga tggcgaagga tgggatcacc      1200
     agcttcacca tgtcgcggat cggctatgat ttcggcaatg tgaagaccga ggcggtgaac      1260
     gcgacgcggc acgtggaggt tggaggcaag ggcgagcttg gcggttcctg gcactgggac      1320
     gcccattatt cctacggccg gaacaattat gacggctata gcttcaacaa caccatcagc      1380
     gccaacgtgc ccctggctgc ggacgcggtc ttcaacagcg cgggcaagat cgtctgccgt      1440
     tcgacgcgcg acgtgaatcc caacaatggc tgcgtgccgc tgaacctgtt tggtgcaggt      1500
     tctccatccg ccgccgccat caactatgtc aacggcaccg gccatacgac ggtgaagtat      1560
     atccagcaca gcgcggcggc gaacctgcgg ggcaatctgt tctcgacctg ggcggggcca      1620
     gtctcggccg cggtcggcat cgaatatcgg cgcgaaagcg agaatgtcgg cgccgatccg      1680
     atcgcggcgg cgaacggctt ttcgtccacg ggcaacgccg tcccttatcg cggcagcttc      1740
     gacgtcaagg aagcctatgt cgaggcgatc gtgccgctgg cgaaggacaa gcccttcctg      1800
     cgttcgctga acatcaacgg cgcggctcgc ttcgcccatt acagcacggt gggcgatcag      1860
     gtgacctgga aggtcggcgg cgtgtgggag ccggtggacg gcctgcgcct gcgcgtcacg      1920
     cggtcgcgcg acattcgcgc gccggccatc tgggaactcg ccagccccgg caacttcgtg      1980
     accaacacga tcaccgtgaa cggcataacc aagatcattc cgcagaatgt ttcggccggg      2040
     aaccccgacc taaaggccga gaaggccgat accttcactg ctggcgtggt cgtcgagccg      2100
     ggcggattcc tgcgcgggct gcgcgcgtcg gtcgactatt acgacatcaa tctgaagggt      2160
     gcgatcacca atttgtccgg cctcaacgtc gcgtcgctct gcacgctcgg ccagcaggaa      2220
     ttctgcagcc tgttcacgtt cgatgcagcc ggcaatccca ccagtctcac ggcgccggcc      2280
     ctcaacgtgg gctcgttccg gaacaagggc ctggatatga cgctgagcta tggttttccg      2340
     ctgggggaag gccgggtgag catcgcggcg agcggcacct atgtcttcaa cgcgctggtc      2400
     gatccgggca ccggcgccgg cgcgatcgag cgcgtgggcg agatgggcca ggccaatctc      2460
     ggcgcgatgc cgcgcttccg cggcaacctg gccgtcacct atacgcgcgg gccgttctcg      2520
     atcacgccgc agttaaactt catctcggca ggcaagcagg acaatatcta caacaccacg      2580
     cccgcgctga cgatcaacga caaccatgtg ccggcgttcg cctatctcga cctggccggc      2640
     tcgatcgacg cgacgcagca gttccggttc ttctggtcga ttgagaacct gctggacaag      2700
     gatccggcgc cgacgcccta cgcggtgctg aacgtgccga ccaacggcat ctggtacgac      2760
     aaggtcgggc ggcgcttcat ggcgggcgtg cgcgtgcggc tgtga                      2805
//

If you have problems or comments...

PBIL Back to PBIL home page