(data stored in SCRATCH zone)

EMBL: AP010803.PE215

AP010803.PE215       Location/Qualifiers
FT   CDS_pept        226162..226983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02150"
FT                   /product="conserved hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95049"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG7"
FT                   /protein_id="BAI95049.1"
FT                   /translation="MSEQPANTRPGAVIGRRELLAAGVAALTVPAMARAQYTRMPPGIA
FT                   KSLTLLIRKPGATHEEFMRYWLGVHAPMALKIPGMRGMVCNEVLGPSRGRNDIPGGTPI
FT                   LIDGVAESWKLESNSPSNPDAPPEARAWYSDGPLFVGEIQGYRVTENVMVPVKRGGKGL
FT                   FSLLQRKPGTTHAAFVDHWLRVHGAMASKVPEVAGLILNEVVAPARRSDIPPFSHALGE
FT                   VDGIAQSWHKDQSYRGVTSPEAKAWYADGAASIGFARGYYTQEHVVIDPHP"
     atgtcggagc aacccgcgaa cacgcgtccc ggtgccgtga tcgggcggcg cgaactgctt        60
     gcggcggggg tcgcggcact gaccgtgccg gcgatggcgc gcgcgcaata tacgcgcatg       120
     ccgcccggca tcgccaagtc cctgaccctg ctcatccgta agccgggcgc cacgcatgag       180
     gagttcatgc gctattggct gggagtgcac gcgccgatgg cgctcaagat tccgggcatg       240
     cggggcatgg tctgcaacga ggtgctgggc cccagccggg ggcggaacga catacccggc       300
     ggcacgccga tcctgatcga cggggtcgcg gaatcctgga agctggagag caactcgccc       360
     agcaatcccg acgccccgcc ggaggcgcgc gcctggtata gcgacgggcc gttgttcgtc       420
     ggcgagatcc agggctatcg cgtcaccgag aatgtgatgg tgccggtgaa gcggggcggc       480
     aaggggctgt tctcgctgct ccagcgcaag ccgggcacga cccacgcggc ttttgtcgac       540
     cactggctcc gcgtgcatgg cgcgatggcg agcaaggtgc cggaagtcgc tggcctgatc       600
     ctgaacgagg tcgtggcgcc ggccaggcgg agcgacatcc cgcccttcag ccacgcgctc       660
     ggcgaggtgg atggcatcgc ccagtcctgg cacaaggatc agagctaccg gggcgtaacg       720
     tcgcccgagg ccaaggcctg gtacgccgac ggcgcggcga gcatcgggtt cgcgcgcggc       780
     tattacaccc aggagcatgt ggtcatcgat ccacatccgt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page