(data stored in ACNUC7421 zone)

EMBL: AP010803.PE217

AP010803.PE217       Location/Qualifiers
FT   CDS_pept        227980..230805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02170"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95051"
FT                   /db_xref="GOA:D4YXG9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG9"
FT                   /protein_id="BAI95051.1"
FT                   /translation="MRPWRLLNTSSLVPLAATGSLALATAAQAQGAPAQGAPAQAAAQP
FT                   TASDIVVTGTRISGFTAPTPVTAISQAQLQEKAVHTVSELLQDIPQLRINQNVGKSSEP
FT                   VGASTADLRGLGPQRTLVLLDGRRLPLTDPAGTIDTNVIPTALISNVEIVTGGASAAYG
FT                   SDAVAGVVNFTLERNLEGFRGDLSYAQTKYDDFHRPAVSLAYGHGFMDDRLHVEAAFDY
FT                   LRNSGQTSQASRPWGSHRTALLTNPNYTATNGQPRLIIADNSTFSQMTPGGVLGRTSGL
FT                   ALARLLGFPTGTGVQFGPNGQPVPFNYGTNVGGTYMTGGDGGSFEDGGNLLPILKRYTG
FT                   YGRIDFDLTQDIKLFGDYLESRTETRSDLTANYDNGTLTINADNAYLPAALRSAMAAAN
FT                   MSSFALGRQQLEDGTAFFSTRTTMRRGAIGIEGKFGGWSWDVSGQIGSTHYRQDSTNNR
FT                   IQTRFFNAVDAVINPATGQPVCRVTLQNPGSSNPDISGCVPVNLFGAGAINQAAQAYYL
FT                   GNSWQSSVQREKVFYLNLKGSPFTTWAGDVSLAAGAEYRTEQTVLTSDPDSAAARWRSI
FT                   NAQPFSGKYNVKEVYGEVVVPLARDMAFAKNLELNGAVRYTDYSTSGGVATWKVGLNYA
FT                   PVSDIRFRGTISRDIRAPNNYELFSRGNQVISQLVDRPSNVSGQVLQVTSGNPDLKPEK
FT                   ADTRAIGAVFQPGWLPGFRMSVDYYSIKIKDAISTVSGQNIVDFCFNGQTVYCASVVRD
FT                   ASGRLTRVNVVPFNAQSQKTSGIDFEAMYRFPLRTFGEGTMTFRVLANYVAELKTIANG
FT                   ATNDYVGLAGVSPPPLGVPQWRFNAEARYQIGRAKLGVTYSFIDGGKYDTRFNVTTLDI
FT                   DNNNIPSRGYVDLDASYKLTGNFDIYGRIDNLFNVAPPIAPNAIVQPQIANSPFYDTRG
FT                   MFWTLGVRARF"
     atgcgtccat ggcggctatt gaacacgtcc agtctggtgc cgctggcggc caccgggagt        60
     ttggcgctgg cgacggccgc ccaagcccag ggtgctccag cccagggcgc tccggcgcag       120
     gccgcggctc agcccaccgc gagcgatatt gtcgtcaccg gcacgcgcat ctccggcttc       180
     accgccccga cgcccgtcac cgccatcagc caggcgcagt tgcaggagaa ggcggtccac       240
     accgtctccg aactgttgca ggatatcccc caactgcgca tcaaccagaa tgtcggcaag       300
     tcgagcgagc cggtcggcgc gagcaccgcc gatctgcgcg gcctcggccc gcagcgcacg       360
     ctcgtgctgc tcgacggccg ccgcctgccg ctgaccgatc ccgcgggcac gatcgacacc       420
     aatgtcatcc ccaccgcact gatcagcaat gtcgagatcg tcaccggagg cgcgtcggcg       480
     gcctatgggt cggacgcggt ggccggcgtc gtcaacttca cgctggagag gaaccttgag       540
     gggttccgcg gcgacctgtc ctatgcgcag accaaatatg acgacttcca tcggccggcg       600
     gtgtcgctcg cctatgggca tggcttcatg gacgaccggc tgcacgtgga ggccgccttc       660
     gactatctac gcaattcggg ccagaccagc caggcgtcgc ggccctgggg ttcgcatcgc       720
     acggcgttgc tgaccaaccc gaactacacg gccaccaacg gccagccgcg cctgatcatc       780
     gccgataatt ccaccttttc gcagatgacg ccggggggcg tgctcggccg tacgtcgggg       840
     ctcgcgctcg ccaggctgct cggtttcccc accggcaccg gcgtgcaatt cggtccgaac       900
     ggccaacctg ttcctttcaa ttacggcacg aatgtcggcg gcacctacat gaccggcggc       960
     gacggcggca gcttcgagga tggcggcaat ctgctgccga tcctgaaacg ctataccggc      1020
     tatggccgga tcgatttcga cttgacgcag gacatcaagc tgttcggcga ctacctcgaa      1080
     tcccgcaccg agacccggag cgatctcacc gccaattatg acaatggcac gctgacgatc      1140
     aatgcggaca acgcctatct cccggctgcc ctgaggtcgg cgatggccgc cgccaatatg      1200
     agcagcttcg ccctcggccg ccagcagcta gaggacggca cggctttctt ctccacgcgc      1260
     acgacaatgc ggcgcggcgc gatcggcatc gagggcaagt ttggcggctg gagctgggat      1320
     gtttctggcc agatcggcag cactcattac cggcaggaca gcaccaacaa ccgcatccag      1380
     acgcgcttct tcaacgcggt cgacgcggtc atcaatcccg ccaccggcca gcccgtctgc      1440
     cgcgtgacgc tgcagaatcc ggggagcagc aatcccgaca tcagcgggtg cgtgccggtc      1500
     aacctgttcg gcgcgggggc gatcaaccag gcggcgcagg cctattatct cgggaatagc      1560
     tggcaatcct ccgtgcagcg cgagaaggtg ttctacctga acctgaaagg ttcgcccttc      1620
     acgacctggg ccggcgacgt ctcactggcg gcgggcgcgg aatatcgcac cgagcagacc      1680
     gtgctcacct ccgaccccga ctccgccgcg gcgcgctggc gctcgatcaa cgcccaaccc      1740
     ttttcgggca agtataacgt caaggaagtc tatggcgagg tggtcgtgcc gctggcgcgc      1800
     gacatggcct tcgccaagaa tctggagttg aacggagcgg tgcgctacac ggattattcc      1860
     accagcggcg gcgtggcgac gtggaaggtc ggtctgaatt acgcgccggt cagcgatatc      1920
     cggttccgcg gcacgatctc ccgcgatatc cgcgcgccca ataattatga actgttctcc      1980
     cgcggcaatc aggtgatcag ccaactcgtc gaccggccca gcaatgtctc cggacaggtg      2040
     ctgcaggtga cgagcggcaa tcccgacctg aagccggaga aggcggacac gcgcgccatc      2100
     ggcgccgtgt tccagccggg ctggctgccg ggcttccgaa tgtcggtcga ttattattcg      2160
     atcaagatca aggacgcgat ctccaccgtg tccggccaga acatcgtcga tttctgcttc      2220
     aacggccaga ccgtctattg cgccagcgtc gtgcgggatg cctcgggcag gcttacgcgg      2280
     gtgaacgtcg tgccgttcaa tgcgcagtcg cagaagacat cgggcatcga tttcgaggcg      2340
     atgtaccgtt tccctctcag aaccttcggc gagggcacga tgaccttccg ggtgctggcc      2400
     aattacgtgg ccgagctgaa gacgatcgcc aatggcgcga ccaatgacta tgtgggcctc      2460
     gcgggtgtct cgccgccgcc gctgggcgtc ccccagtggc gcttcaacgc ggaggcacgg      2520
     taccagatcg ggcgcgccaa gctgggcgtg acctacagtt tcatcgacgg cggcaaatat      2580
     gacacccgct tcaacgtcac cacgctcgac atcgacaaca acaatattcc cagccgcggt      2640
     tatgtcgacc tcgacgcgag ctacaagctg accgggaatt tcgacatcta tgggcggatc      2700
     gacaatctgt tcaatgtcgc gccgccgatc gcgccgaacg ccatcgtcca gccgcagatc      2760
     gcgaactcgc ccttctacga tacgcgcggc atgttctgga cattgggggt ccgtgcgcgg      2820
     ttctga                                                                 2826
//

If you have problems or comments...

PBIL Back to PBIL home page