(data stored in ACNUC7421 zone)

EMBL: AP010803.PE218

AP010803.PE218       Location/Qualifiers
FT   CDS_pept        complement(230815..231306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95052"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH0"
FT                   /protein_id="BAI95052.1"
FT                   /translation="MTATPPADPRFAANAIPCDGCTLCCFNEQVILRPEAGDVLDDFDW
FT                   EYIASDLYPGQRVPALKRDPATGHCVYLTETGCSIHERAPAICRRYHCARTFKALGRMS
FT                   RCRRDILWAMGNVLDRAQVERGRDRLQRARELGIDHLIDTDAQVRAFERIADAHKSGRR
FT                   "
     gtgacggcga cgccgccagc cgatccccgg ttcgcggcca acgccatacc gtgcgacggc        60
     tgcacgctct gctgcttcaa cgagcaggtg atcctgcgcc ccgaggcggg cgatgtgctg       120
     gacgatttcg actgggaata tatcgcgagc gatctctatc cgggtcagcg cgtcccggcg       180
     ctgaaacgcg atcccgcgac cgggcattgc gtttatctga cggaaaccgg ctgttcgatc       240
     cacgagcgcg cgcccgcgat ctgccggcgc tatcattgcg cccgcacctt caaggcactc       300
     ggccggatgt cgcggtgccg gcgggacata ttatgggcga tgggcaatgt gctggacagg       360
     gcgcaagtcg agcgcggccg cgaccgcctc cagcgcgccc gcgaactggg gatcgatcat       420
     ctgatcgaca cggacgcgca ggtccgggct ttcgagcgca tcgccgacgc ccacaagtcc       480
     gggcggcgct ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page