(data stored in ACNUC7421 zone)

EMBL: AP010803.PE219

AP010803.PE219       Location/Qualifiers
FT   CDS_pept        complement(231413..232366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95053"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH1"
FT                   /protein_id="BAI95053.1"
FT                   /translation="MRRARWMGLAVAAGLLGAAAPPPPPPPPEIAIPQPRVFPESITAT
FT                   RDGTLIVGSAGNGTIWRARPGDKAATIFIAPDSSGLVSVLGVFADDRHGLLYVCSNGRR
FT                   GDPTEARDRAAAIRLFDLKSGAPVRNIPTPGASRSLCNDFAVAPDGTAYVAETLRGSII
FT                   RVRGDKADVWIADPRLAGADGIAFDNDGQLYVTSVTSGRMFRTGASADGSARPLVELIP
FT                   PRKLDRPDGLRHIGPGRFLLAEAGDEGGITLMTVKGDMVTLSPLPGGRAGTTSAVALGK
FT                   TSWAVAGKLRYRTDPALAGQDPGPFAIYGTPIRAGR"
     atgcgacggg cgcgatggat ggggctggcg gtggcggcgg ggctgcttgg ggcggcggcc        60
     ccgcccccac ccccgcctcc gcccgaaatc gcaattcccc agccgcgcgt cttccccgaa       120
     agcatcaccg cgacgcgcga cggcacgctg atcgtcggca gcgcgggcaa tgggacgatc       180
     tggcgcgccc ggcccggtga caaagccgcc accattttca tcgcgccgga cagcagtgga       240
     ctcgtgtcgg tgctgggcgt gttcgcggac gacaggcatg gcctgctcta tgtctgctcc       300
     aacggccgac gcggcgaccc gaccgaggcg cgcgaccgcg ccgcggcgat ccgcctgttc       360
     gacctcaaga gcggcgcgcc ggtcaggaat attcccaccc ctggcgcctc tcggtcgctg       420
     tgcaacgact tcgcggtcgc gcccgacggc accgcctatg tcgcagaaac gctgcgcggc       480
     tcgatcatcc gcgtgcgcgg ggacaaggcc gatgtctgga tcgccgatcc gcgcctggcg       540
     ggcgctgacg gcatcgcctt cgacaacgac ggccagctct acgtgaccag cgtcacgtcc       600
     ggccgcatgt tccgcaccgg cgcgtccgcc gatgggagcg cgcgtccgct ggtcgaactc       660
     atcccgcccc gcaagctcga ccgtccggac ggcctgcgcc atatcggccc cggtcgcttc       720
     ctgctcgccg aggcgggcga tgagggcggg atcacgctca tgaccgtcaa gggcgacatg       780
     gtgaccctct ccccgctccc cggcggccgc gccggcacga cctcggcggt ggcgctgggg       840
     aagacctcct gggcggtcgc gggcaagctc cgctatcgca ccgatcccgc gctggctggg       900
     caggatcccg gtcccttcgc catctatggc acgcctatcc gagcaggacg atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page