(data stored in ACNUC7421 zone)

EMBL: AP010803.PE220

AP010803.PE220       Location/Qualifiers
FT   CDS_pept        complement(232383..232925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95054"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH2"
FT                   /protein_id="BAI95054.1"
FT                   /translation="MSLGLVFVMGAPDAGADGLSLPEGALAPVPWVGRTMSSRAGEPGR
FT                   PRHMLLADSAAKTDLAGAAGAWRWSGVQILPGDEPAPRNAGGLLVNWMNIDGAHEEEFN
FT                   DWYDTEHVPRFRAVDGVLAARRFRASTGQPSYAAFYHLRDLDVVTGAQWREAATTPWSA
FT                   RILTFRHDNLRMGFTPA"
     ttgagcctcg gtctcgtctt cgtgatgggt gcgcccgacg cgggggcgga cggcctgtcc        60
     cttcccgaag gcgcgctggc gccggtgcca tgggtcggcc ggaccatgtc cagccgggcg       120
     ggggagccgg ggcggccgcg ccacatgctg ctggccgaca gcgcagcgaa gacggacctc       180
     gccggggcgg cgggcgcatg gcgctggtcg ggcgtccaga tcctgccagg cgacgagccg       240
     gcgcccagga acgcgggcgg cctgctcgtg aactggatga acatcgacgg cgcgcacgag       300
     gaggagttca acgactggta cgataccgag catgtgccgc gcttccgggc ggtggacggc       360
     gtactcgccg cgcggcgctt ccgcgcttcg acaggccagc cgagctacgc ggccttttat       420
     cacctgcgcg acctggacgt ggtgaccggc gcccagtggc gcgaagccgc gacgacacca       480
     tggagcgcgc ggatattgac tttccgccat gacaatctgc ggatgggttt cacccccgcc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page