(data stored in ACNUC7421 zone)

EMBL: AP010803.PE223

AP010803.PE223       Location/Qualifiers
FT   CDS_pept        complement(234304..235254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02230"
FT                   /product="putative extradiol ring-cleavage dioxygenase"
FT                   /note="putative extradiol ring-cleavage dioxygenase, class
FT                   III enzyme, subunit B / protocatechuate 3,4-dioxygenase
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95057"
FT                   /db_xref="GOA:D4YXH5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH5"
FT                   /protein_id="BAI95057.1"
FT                   /translation="MLNMRDGDWARFEERDIPGKFLDKEGRPATYAMLLERADKALRDH
FT                   ITPALLDERMRAAKRGVERIRAAIVASGIDTLIVIGDDQAELYTNDNLPSILIYYGETI
FT                   RNNPRHKGNPNPLEWWQNARGGYYVDEGETDFPVDAGLARHMIARLVDDEFDISTANRL
FT                   RDGEGEGHAFGFVHRQLMDEANPLPIVPLALNTYYAPNQPTPRRCYALGQAIRRAVESY
FT                   PEDIKVGVIASGGLSHFVVDEELDRGLIEAIRAKDVAALTSMDRAKLNSGSSEIRNWIA
FT                   TAGACEHLDLAWSEYLPCYRTEAGTGTGVCFAEWH"
     atgctcaaca tgcgcgacgg cgattgggcg cggttcgagg agcgcgacat cccaggcaag        60
     ttcctcgaca aggaagggcg tccggcgacc tacgccatgc tgctggaacg cgcggacaag       120
     gcgctgcgcg accatatcac gcccgcgctg ctcgacgagc gcatgcgcgc cgccaagcgg       180
     ggggtcgagc ggatcagggc ggcgatcgtc gcctccggca tcgacacgct gatcgtcatc       240
     ggcgacgacc aggccgagct ttacaccaac gacaatctgc cgagcatcct catctattat       300
     ggcgagacga tccgcaacaa cccgcgccac aagggcaatc ccaacccgct cgaatggtgg       360
     cagaacgcgc gcggcggcta ttatgtggac gagggcgaga ccgacttccc ggtcgacgcc       420
     gggcttgcgc gccacatgat cgcccggctg gtcgatgatg aattcgacat ctccaccgcc       480
     aaccggctgc gcgacggcga gggcgagggc catgccttcg gcttcgtcca ccgtcagttg       540
     atggacgagg ccaacccgct gccgatcgtg ccgctggcgc tcaacaccta ttatgcgccc       600
     aaccagccga cgccgcgccg ttgctatgcg ctcggccagg cgatacgccg ggcggtcgaa       660
     agctatccgg aggacatcaa ggtcggcgtc atcgcctcgg gcggcctcag ccatttcgtg       720
     gtcgacgaag agttggaccg cggcctgatc gaggcgatcc gcgccaagga tgtcgccgct       780
     ctcacgagca tggatcgggc gaagctcaat tcaggcagct cggaaatccg caactggatc       840
     gctacggccg gcgcgtgcga acatctcgac ctcgcctggt cggaatatct gccctgctac       900
     cgcaccgaag cgggcacggg cacgggcgtt tgcttcgccg agtggcattg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page