(data stored in ACNUC7421 zone)

EMBL: AP010803.PE228

AP010803.PE228       Location/Qualifiers
FT   CDS_pept        239623..240216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02280"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95062"
FT                   /db_xref="GOA:D4YXI0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXI0"
FT                   /protein_id="BAI95062.1"
FT                   /translation="MPRIPFPEFATMNPAQRAVYEAIVSGPRGGLVGPLRAALHNPELA
FT                   DKWQRFGELLRFRTSLTKRHSELAILVTARVWNCSFEWFQHEPHALAAGLPAGIVNALR
FT                   MEQRPDFDDSADEAIYEFTNQLQRDHSVTDAAHRAVQAVYGVTGVVELTALIGYYALVA
FT                   MTLNAHAFDLPEGATDPFAGQAGTDAAAIHPSTE"
     gtgccgcgca ttccgtttcc tgaattcgcg accatgaatc ccgcccagcg cgcggtgtat        60
     gaagcgatcg tgagcggccc gcgcggaggg ctggtcggcc cgctccgcgc agcgctgcac       120
     aatcccgaac ttgccgacaa atggcagcgg ttcggcgaat tgctgcgctt ccgcacctcg       180
     ctcaccaagc ggcatagcga gctcgccatc ctcgtgacgg cgcgtgtctg gaactgttcg       240
     ttcgagtggt tccagcatga gccgcatgcg ctggcggccg gccttcccgc cgggatcgtg       300
     aacgcgctcc gcatggagca gaggccggat ttcgacgatt cggccgacga ggcgatctac       360
     gaattcacca accagcttca gcgcgaccac tccgtcaccg acgcggcgca ccgcgccgtc       420
     caggcggtct acggggtgac gggcgtagtc gaactgaccg cgctgatcgg ctattatgcg       480
     ttggtggcaa tgacgctcaa cgcgcacgcc ttcgatttgc ccgagggcgc gaccgatcct       540
     ttcgccggac aggccgggac tgacgccgcc gcgattcatc catccaccga ataa             594
//

If you have problems or comments...

PBIL Back to PBIL home page