(data stored in SCRATCH zone)

EMBL: AP010803.PE239

AP010803.PE239       Location/Qualifiers
FT   CDS_pept        252291..252785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95073"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ1"
FT                   /protein_id="BAI95073.1"
FT                   /translation="MEEGSPMSARFWLFSCACAGAALTGGFGLGLYATTPPRFGTETVL
FT                   PQAVSPDGADYDMMSANLAGPAVVRCDGCGPTLADRQMAADMAGWDGMNDPVVRDYAAQ
FT                   DDGMTPDHAEPPPPVRMLPASIERFADGEGEGSFQPVRIARAPDSGTSAEEAPADAAMS
FT                   Y"
     atggaggaag ggtcgcccat gtccgcgcgc ttctggttgt tttcatgtgc atgcgcaggc        60
     gctgcgctga ccggcggttt cggccttggc ctgtacgcca cgacgccgcc caggtttgga       120
     accgaaaccg tgctgccgca ggcggtcagc cccgacgggg ccgattacga catgatgtcg       180
     gccaatctgg ccggcccggc cgtcgtccgc tgcgacggct gcggtccgac gctggccgac       240
     cggcagatgg cggcggacat ggccggctgg gacgggatga acgatcctgt cgtgcgcgat       300
     tatgcggcgc aggacgatgg aatgacgccc gaccatgccg aaccgccccc gccggtccgg       360
     atgctgcccg cctccatcga aagattcgcc gatggggagg gagaaggcag tttccaaccc       420
     gtcaggatcg cgcgggcgcc agacagcgga acgtccgccg aggaagcccc ggcggacgcc       480
     gccatgtcct actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page