(data stored in SCRATCH zone)

EMBL: AP010803.PE241

AP010803.PE241       Location/Qualifiers
FT   CDS_pept        complement(257344..257931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95075"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ3"
FT                   /protein_id="BAI95075.1"
FT                   /translation="MIACLIMLAAASTAAQSSATQIAQATFQPERAIADALAQWDAQFD
FT                   AGVTRASVGRTMTADQEARKNRAKAAGKAELSQQLRTTGIPKMLHLIEADYIQNFSEEE
FT                   LREAAIFWTSPAGQAFTAAMQEAVKNGTGRIVPPAQHAAAINRYMTSATGRKESVRSGI
FT                   LRPVLAKEMGLFMQQAQPKIDARMRAAMSAAS"
     gtgatcgcat gtctcatcat gctggccgca gcttccactg ctgcgcaatc ttcggcaacg        60
     caaattgcgc aggcgacgtt tcagccggag cgtgccatcg ctgacgcgct tgctcagtgg       120
     gatgcgcagt ttgatgctgg cgtgacgcgt gcttccgttg gcagaacgat gacggccgac       180
     caagaggctc ggaaaaaccg agccaaggcg gctggcaagg cggagctttc gcaacaatta       240
     aggacgaccg gcattccaaa aatgctgcac ctgattgagg cggattatat ccagaacttc       300
     tctgaggaag agttgcggga agccgccata ttctggacat cgccggcagg gcaggcgttc       360
     accgccgcca tgcaggaagc tgttaagaac ggaactggcc ggatcgtgcc cccagcacag       420
     catgccgcag ccatcaaccg ctacatgacg tctgctacag ggcgcaaaga aagcgtccgg       480
     tctgggatcc tccgccctgt tctcgccaaa gaaatgggcc tgttcatgca gcaggctcag       540
     cccaagattg atgcacggat gagggcggca atgtccgccg cgtcctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page