(data stored in ACNUC7421 zone)

EMBL: AP010803.PE245

AP010803.PE245       Location/Qualifiers
FT   CDS_pept        complement(261653..262384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02450"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95079"
FT                   /db_xref="GOA:D4YXJ7"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ7"
FT                   /protein_id="BAI95079.1"
FT                   /translation="MAERPWRAGCEGWFDVLSASGETNGIIFSVRPGGRGWWHCVFTFA
FT                   RPGQTPMEAFFTSTALVALAEMGDKTQLLAMLLATRFRKPVPIILGILAATLANHFLAA
FT                   LVGHSVAGALTQPWFRYAVAASFIAMAVWTLIPDKFDEDEPLKAPSRAGVFMTTLIAFF
FT                   LVEMGDKTQVATVMLGARFDNILAVTAGTTLGMMIANVPAVLFGGALARKVPMRALQVG
FT                   AALLFLALGLWMIADLRGWIG"
     ttggccgaga ggccatggcg ggcgggatgc gaggggtggt tcgacgtcct atccgcatcg        60
     ggcgagacca atggcatcat cttctccgtc cggccgggcg ggaggggatg gtggcattgc       120
     gtcttcacct tcgcccggcc cggacagacc ccgatggaag catttttcac ctccaccgcc       180
     ctcgtcgcgc tcgccgaaat gggggacaag acgcaattgc tggcgatgct gctcgccacc       240
     cgcttccgca agccggtgcc gatcatcctc ggcatattgg ccgcgacgct cgccaaccat       300
     ttcctcgccg cgctggtcgg ccattcggtc gcgggcgcgc tgacccagcc ctggttccgc       360
     tacgccgtcg ccgccagctt catcgccatg gcggtctgga cgctgatccc cgacaagttc       420
     gacgaggacg aaccgctcaa ggcgccgtcg agggcgggcg tgttcatgac caccctgatc       480
     gccttcttcc tggtggagat gggcgacaag acgcaggtgg cgaccgtgat gctgggcgcc       540
     cgcttcgaca atatcctcgc cgtcactgcg ggcacgaccc tcggcatgat gatcgccaat       600
     gtgcctgccg tgctgttcgg cggcgcgctg gcgcggaagg tgccgatgcg cgcgctccag       660
     gtcggggcgg ccctgctgtt cctggccctc ggcctgtgga tgattgctga tttgcggggc       720
     tggatcgggt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page