(data stored in SCRATCH zone)

EMBL: AP010803.PE247

AP010803.PE247       Location/Qualifiers
FT   CDS_pept        complement(263492..263920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95081"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ9"
FT                   /protein_id="BAI95081.1"
FT                   /translation="MSDYAPEDAALLCAVGRLVCAWTMLEQSLEAKVAMMREAMGDVRT
FT                   VGARTRPGMTKLMTELRTMVSMRDRRNAGALMEIADIERDMQRIDRFRSLIIGGFQQPA
FT                   PGGFTCRDARNNQTHVSLEQLEAEIASLERVAQRLLAV"
     gtgtcggatt atgcgccaga ggatgcggcg ctgctatgtg cggtgggccg cctggtctgc        60
     gcctggacga tgctggaaca gagcctggag gcgaaggtcg cgatgatgcg ggaggccatg       120
     ggggatgtgc ggaccgtggg cgcccggaca cgtccgggca tgacgaagct gatgaccgaa       180
     ttgcggacca tggtgtcgat gcgcgaccgg cgcaatgccg gcgcgctgat ggaaatagcg       240
     gatatagagc gcgacatgca gaggatcgac cgattccggt cgctcatcat cggcggcttt       300
     cagcagcccg cgcccggcgg cttcacatgc cgcgatgcgc ggaacaatca gacgcatgtc       360
     tcgcttgagc aactcgaagc ggaaattgct tccctcgaaa gggtggcgca gcgcctgctg       420
     gctgtctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page