(data stored in ACNUC7421 zone)

EMBL: AP010803.PE250

AP010803.PE250       Location/Qualifiers
FT   CDS_pept        complement(265362..267128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02500"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95084"
FT                   /db_xref="GOA:D4YXK2"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK2"
FT                   /protein_id="BAI95084.1"
FT                   /translation="MSDRRRLPPHSAPEEAGPGPEDGIEQGKRLIRIADDKGLSLAQRI
FT                   ANRFYLLSWKTPIHGRRLKGKYPLKLLAVPDDEIPGNAHAGQAIRAGYFLFRGLKLPLD
FT                   KLDFANPGVTAGFADYLHGFHWLRDLATVATREQAAPIAEGVMRKWLAAHADTPSEPAW
FT                   RADNAGWRLLFWSAHAPLILSSSDLVYRSLVLNCIARTARHLDRGADKAPVGLPRLVAW
FT                   GGIVAASMLLPGGAARKLFGEAGLKRALDSGLHGDGGIISRSPLDQLEAIMLLTMVAAV
FT                   YEVRREQTPPFLTEALGRAVPALLGLTHGDGGLGNWQGAGAVDPATIEAVVRASRVRAR
FT                   PLRQATGWGYQRLAAGSTVVQVDAAPPPVAQLADAGCASTGAIEISDGQQRLIVNCGGA
FT                   ALEGAWMPRDLAQGLRTTAAHSTLVLDDSNSTALLPDGTLGKGVTEVEINRQETESGSR
FT                   FDLSHDGYVRRMGYVHRRLLLMSGDGKEIRGEDMLTPAARRRRPVKLPVQLRFHLAPGV
FT                   EPTPTADGMGALLRLDTGATWQFRANAGKLAIEESLWVDAEGRPHGTRQLAVISEALPG
FT                   GSTVGWLLKKVS"
     gtgagcgacc gccgccgcct tcccccccat tccgcccccg aggaggccgg acccggcccg        60
     gaggacggga tcgaacaggg caagcggctc atccgcatcg cggatgacaa ggggctttcg       120
     ctggcgcagc gcatcgccaa tcgcttttac ctgctgagct ggaagacgcc gatccacggc       180
     cggcggctga agggcaaata tccgctcaag ctgctcgccg tgcccgatga cgagattccc       240
     ggcaacgccc atgcgggcca ggcgatccgc gccggctatt tcctgttccg gggcctgaaa       300
     ctgcccctcg acaaattgga cttcgccaat ccgggcgtga cggcgggctt cgccgattat       360
     ctgcacggct tccactggct gcgcgacctg gcgaccgtgg cgacccgcga acaggccgcg       420
     ccgatcgccg aaggggtgat gcgcaaatgg ctcgccgccc atgccgacac gcccagcgaa       480
     ccggcatggc gcgccgacaa tgcgggctgg cgcctgctgt tctggtctgc ccatgcgccg       540
     ctgatcctct catcgagcga cctcgtctat cgctctctgg tgctgaactg catcgcccgc       600
     accgcccgcc atctggaccg cggcgcggac aaggcgccgg tcggcctgcc gcgcctggtc       660
     gcctggggcg ggatcgtcgc ggcgtcgatg ctgctgcccg gcggcgcggc gcgcaagctg       720
     ttcggtgaag ccggcctcaa gcgcgcgctc gacagcggcc ttcatggcga cggcggcatc       780
     atctcgcgct cgccgctgga ccagttggaa gcgatcatgc tgctgaccat ggtcgccgcc       840
     gtctatgagg tgcggcgcga acagacgccc cctttcctga cggaggccct gggaagggcg       900
     gttccggctt tgctgggcct gacccatggc gacggcgggc tgggcaactg gcagggcgcg       960
     ggcgccgtcg atcccgcgac catagaggcc gtcgtccgcg ccagccgcgt gcgcgcccgc      1020
     ccgctgcgac aggccactgg ctggggttat cagcggctgg ccgccggcag cacggtggtg      1080
     caggtggacg ccgcgccgcc gcccgtcgcc caactggccg atgcgggttg cgcctccacc      1140
     ggagcgatag agatcagcga cgggcagcaa cggctgatcg tcaattgcgg cggcgccgcg      1200
     ctggagggcg cgtggatgcc ccgcgatctg gcgcaggggc tgcgcaccac cgcggcgcac      1260
     agcacgctgg tgctggacga cagcaattcc accgcgctgc tgcccgacgg cacgctgggc      1320
     aagggcgtga ccgaggtgga gatcaaccgg caggaaacgg aaagcggcag ccgtttcgac      1380
     ctcagccatg acggctatgt gcggcgcatg ggctatgtcc atcgccgcct gctgctgatg      1440
     agcggcgacg gcaaggaaat ccgcggcgag gacatgctga ctcccgcggc gcgacgccgc      1500
     aggccggtga agctgcccgt ccagctccgt ttccaccttg cccccggcgt ggagcccacg      1560
     cccaccgccg acggcatggg cgcgctgctg cgcctcgaca cgggcgcgac ctggcaattc      1620
     cgcgccaatg cggggaagct ggcgatagag gaaagcctgt gggtggatgc cgagggccgt      1680
     ccccatggca ctaggcagtt ggcggtcatc agcgaagccc tgccgggcgg ctccaccgtg      1740
     ggatggttgc tgaagaaggt gagctag                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page