(data stored in ACNUC7421 zone)

EMBL: AP010803.PE252

AP010803.PE252       Location/Qualifiers
FT   CDS_pept        complement(267892..268377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02520"
FT                   /product="PAS/PAC domain protein"
FT                   /note="FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95086"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK4"
FT                   /protein_id="BAI95086.1"
FT                   /translation="MRPTEPLPLNHSWPLYALRDHLAPVMLDDRIARDDGALAERGLGL
FT                   WHCDLGDDSLNWTDGVYDIFGLERGTAVPRPLAVSLYAPDSCAAMERLRAYAIRHRRGF
FT                   TVDVDIRPADGGECAMRLIAAPVIQRNRVVALHGVKQFLPKGSRPSTRLDPTLFILS"
     ttgcgcccga ccgagcccct tcccctgaat catagctggc cgctatatgc gttgcgcgac        60
     catctggcgc cggtgatgct ggacgaccgg atcgcccgcg acgacggggc gctggcggaa       120
     cgcggcctgg gcctgtggca ttgcgatctg ggcgacgaca gcctgaactg gacggacggg       180
     gtctatgaca ttttcgggct ggagcgcggg acggcggttc cccgcccgct cgccgtgtcg       240
     ctctacgcgc ccgacagctg cgccgcgatg gagcggttgc gcgcctatgc gatccgccac       300
     aggcgcggct tcacggtgga tgtcgacatc cgcccggcgg acggcggcga atgcgccatg       360
     cgcctgatag ccgcgcccgt catccagcga aatcgggtgg ttgcgctgca cggcgtcaag       420
     cagttcctgc ccaagggttc caggccgtcg acgcgccttg atcccaccct gttcatcctg       480
     tcctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page