(data stored in ACNUC7421 zone)

EMBL: AP010803.PE258

AP010803.PE258       Location/Qualifiers
FT   CDS_pept        complement(273000..273689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95092"
FT                   /db_xref="GOA:D4YXL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL0"
FT                   /protein_id="BAI95092.1"
FT                   /translation="MTDLLPPLASLGRLRRDAPKTVAGFRRWRAIIDTDGAVPAKVKRL
FT                   FVACAATMKGYRELATRELAEARAAGLTEAEAGAAIAILASVRGEGASLRFHDLFREIY
FT                   PEATDPDWPDDDMIVEDGAAQANFLQYFGAMPPSLGKLFEVKPLGADAYYLMREGTLSG
FT                   TALGPVYAELLLVTVLVADYSSWASVHMKGARTAGASEEAVAEAVICAVPTAGLSAWVI
FT                   GATAMDA"
     atgactgatc ttctgccccc gctcgccagt cttggccgct tgcgccgcga cgccccgaag        60
     accgtcgcgg gatttcgccg ctggcgcgcg atcatcgata ccgacggcgc cgttcctgcc       120
     aaggtaaagc gattgttcgt cgcttgcgcc gccacgatga agggctatcg ggaactcgca       180
     acgcgggaac tggccgaagc gcgggcggcc ggtctcaccg aggcggaggc gggagcggcg       240
     attgcaatcc tcgcgagcgt gcgcggcgag ggggcgtcgc tgcgcttcca tgatcttttc       300
     cgggagatct accccgaagc caccgatccc gactggcccg acgacgacat gatcgtggaa       360
     gatggcgccg cgcaggccaa tttccttcaa tatttcggcg ccatgccccc ttcgctgggc       420
     aagctgttcg aggtcaagcc tctgggcgcc gacgcctatt atctcatgcg cgaggggact       480
     ttgtcgggga cggcgctggg gcctgtctat gcggaactgc tgctcgtcac cgtcctcgtg       540
     gccgactata gttcatgggc gtccgtccat atgaagggcg cgcgcaccgc cggcgccagc       600
     gaggaagcgg tggccgaagc ggtgatctgc gccgtgccga ccgccggcct gtccgcctgg       660
     gtcatcggcg cgaccgcgat ggatgcgtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page