(data stored in SCRATCH zone)

EMBL: AP010803.PE259

AP010803.PE259       Location/Qualifiers
FT   CDS_pept        273837..274745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02590"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95093"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL1"
FT                   /protein_id="BAI95093.1"
FT                   /translation="MREEQARMRDFKGRTAVITGAGSGIGAALAHLAAREGMNLVLADI
FT                   NLADLEAVAASIDSPAIALQRTDVADPEAVQALADLAWSRFGEVSLLCNNAGVVPGGRH
FT                   RLVWEYALEDWRWAFGVNMDGVVNGIRSFVPRMLAEGRPGHILNTASVAGFVSGEGSAV
FT                   YGASKHAVVRITEALYAGLRERNAPIGVTMLCPGLVATRIYEAERSRPAHLRSSDGRPA
FT                   EAAEFQSISDNLFQNAPSPEEVAAQAFDGIRNDQFYVFTTTRYDPVIAQRTQSILAREN
FT                   PLFDSLISLSKGKADAGEERS"
     atgcgagagg agcaggcccg gatgagggac ttcaagggca ggacggcagt cattacgggg        60
     gccggcagcg gcattggcgc ggcgcttgcc catctggcgg cgcgagaggg gatgaacctg       120
     gtcctcgccg acatcaatct ggccgacctt gaagcggtgg ctgcctccat cgacagtccg       180
     gcaatcgcgc tccagaggac cgacgtggcc gatccggagg cggtgcaggc cctggccgac       240
     cttgcatggt cgcgcttcgg ggaggtgtcc ctgctgtgca acaatgctgg cgtcgtcccc       300
     ggcggccgcc atcggctggt ctgggaatat gcgctggagg actggcgctg ggcgttcggc       360
     gtcaacatgg acggcgtggt gaacggcatc cgcagcttcg tgcccaggat gctggccgag       420
     gggcggccgg ggcatattct caacaccgcg tccgtggccg gcttcgtgag cggcgaaggc       480
     tccgccgtct atggcgcgtc caagcatgcc gtcgtccgca tcaccgaagc cctctatgcc       540
     ggcctgcgcg agcggaacgc cccgatcggc gtcacgatgc tgtgtcccgg cctggtcgca       600
     acgcgcattt acgaggccga acgatcccgc cctgcccatc tgcggtccag cgacgggcgg       660
     ccggccgaag ccgcggagtt ccagtcgatt tcggataatc tgttccagaa tgccccatcg       720
     cctgaggaag tcgccgcgca ggcgttcgac ggcatccgga atgaccagtt ctacgtcttt       780
     accacgaccc gttacgatcc ggtgatcgcg cagcggacgc aatcgatcct tgcgcgggaa       840
     aatccgctat tcgacagcct gatttcgctc agcaagggca aggctgacgc aggggaggaa       900
     aggtcgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page