(data stored in ACNUC7421 zone)

EMBL: AP010803.PE260

AP010803.PE260       Location/Qualifiers
FT   CDS_pept        274742..275494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02600"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95094"
FT                   /db_xref="GOA:D4YXL2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL2"
FT                   /protein_id="BAI95094.1"
FT                   /translation="MSRLQGRIALVTGAASGIGLATARRFAAEGATLILSDRNGDALSD
FT                   AAKSLPGDGHEVVVMDVTDEQAWIALADRVKTRFGTLDILVNNAGFGKFASIADTTLAQ
FT                   WRSIIAVNLDSVFLGTKYMMPLLAASGRGAIVNMSSIRGIVAGAGTGSYSAAKGGVRMF
FT                   TKATAIECAAAGNGVRANSIHPGHIATPLTAPAHADAEIARSLLADVPLGRIGQAEEIA
FT                   DGILFLASDESRYMTGAELVIDGGSTAQ"
     gtgagcaggc ttcaggggcg gatcgcgctc gtcaccggcg ctgcttcggg catcgggctc        60
     gccaccgccc ggcgcttcgc ggcggagggc gcgacactca ttctgtccga ccgcaacggg       120
     gatgccctgt cggatgcggc caagtccctg ccgggcgatg gccatgaggt cgtggtcatg       180
     gacgtcaccg acgagcaggc atggatcgcg ctggccgatc gcgtgaaaac gcggttcggc       240
     acgctcgaca tcctcgtcaa caatgccggg ttcggcaagt tcgcgtcgat cgcggacacg       300
     acattggcgc aatggcggtc gatcatcgcc gtcaatctcg acagtgtttt cttaggcacc       360
     aaatatatga tgccgctgct cgccgcctcc ggccgggggg cgatcgtcaa catgtcctcc       420
     attcggggca tcgtggcggg cgcgggcacc ggctcctaca gcgcggcgaa ggggggcgtc       480
     cggatgttca ccaaggcgac cgctatcgaa tgcgcggcgg ccggcaacgg cgtgcgggcg       540
     aactccattc accctggtca catcgcgacg ccgctgaccg cgcctgccca tgccgatgcg       600
     gaaatcgcca ggagcctgct ggcggacgtc ccgctcggcc ggatcgggca ggcggaggag       660
     atcgccgacg gcatcctttt cctggccagc gacgaatccc gctacatgac gggcgccgaa       720
     ctcgtgatcg acggcgggag caccgcgcaa tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page