(data stored in ACNUC7421 zone)

EMBL: AP010803.PE262

AP010803.PE262       Location/Qualifiers
FT   CDS_pept        276648..278087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02620"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95096"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL4"
FT                   /protein_id="BAI95096.1"
FT                   /translation="MSAGRSMPAMRPMLVLLPLLASTAGHAEPASFAAPEAPISQPGYG
FT                   EDLLPRDEKDRATLLRTVAFDATVYGMAAYLHYEQLYRQVFDRSSSNYTGFNRFAHERN
FT                   LAGPDYATFKVPNTDTLYSTAWIDLSKGPVEIDIPATQLKYFTLNIFDIFGNPSNLSNR
FT                   TIGVKGGRFLLVPRNWRGTAPAGVMVYPAATTQLWILMRAFAQSDAEVRTARAFQDAVR
FT                   IIAPEGEGPADSHGGASPPPPAPGAIGYFGALDHVLRANGWQPGEEALVSRFRPLGIGD
FT                   DRPFNPDRLTPATQAAIESGYAEALDMLTRAKSQLGEPTGTGWMKVNKGVYGFNYLRRS
FT                   VINMAGLGANVREENASYTTFADRNGSALDGASSRYMLRLQTPPPVNSFWSVTLYDAKT
FT                   FALHPNPLRRYLVSDRTKGLKVRKDGSIEIRIQHAASSDGNWLPAPAGPFFVVIRAYGP
FT                   KPDMLNGQWLPPPISREGDAR"
     atgagcgccg gacgatcaat gccggccatg cggccgatgc tggttctcct gccgctcctt        60
     gcctcgaccg ctggacatgc cgagccagcg agcttcgccg caccagaggc gcccatttcg       120
     cagcccggat atggcgaaga cctgctgccc agggacgaga aggatcgcgc caccctgctc       180
     cggaccgtcg ccttcgatgc gaccgtctat ggcatggctg cctatctgca ctatgagcaa       240
     ctctatcggc aggtgttcga tcgaagttcc agcaactaca cggggttcaa ccgcttcgcg       300
     catgagagga accttgcggg gccggactat gccacgttca aggtgcccaa tacggacacg       360
     ctttactcca ccgcgtggat cgacctgagc aaggggccgg tcgaaatcga catcccggcc       420
     acgcagctca aatatttcac gctcaacatc ttcgatattt tcggcaatcc cagcaacctc       480
     agcaatcgca cgataggcgt caagggcggc cgcttcctgc tggtgccgcg caactggcgc       540
     ggcaccgcgc ccgccggggt catggtctat ccggccgcca cgacccagct ttggatcctg       600
     atgcgcgcct tcgcccagtc cgacgccgaa gtccggaccg cgcgcgcttt tcaggatgcg       660
     gtcaggatca tcgctccgga aggcgaaggg ccggcggatt ctcatggcgg cgcatcgcca       720
     ccaccacccg cccctggcgc tatcggctat ttcggggcgc tcgaccatgt gcttcgggcc       780
     aatggctggc agccgggcga ggaggcgctt gtgtcgcgat tccgaccgct cggcataggg       840
     gacgaccgcc cgttcaaccc tgacaggctg accccggcca cgcaagccgc catcgaaagc       900
     ggttacgcgg aggcgctgga catgctcaca cgcgccaagt cgcaattggg cgaacccacc       960
     ggcacgggct ggatgaaggt caacaagggc gtctacggtt tcaattatct gcgccggtcc      1020
     gtcatcaaca tggctggcct cggcgcgaat gtgcgggagg aaaatgcctc ctacaccacg      1080
     ttcgcggacc gcaatggatc ggcgctggac ggcgcgtcgt cgcgctacat gctccggctg      1140
     caaacgcccc cgcccgtcaa cagcttctgg tccgtcacgc tctacgacgc aaagaccttc      1200
     gccctccatc ccaatccgct gcgtcgctat ctggtgagcg accggacaaa gggcctgaag      1260
     gtgcggaagg acggctccat cgaaatccgc atccagcatg ccgcatcatc cgatggaaac      1320
     tggcttcccg caccggcggg cccatttttc gtcgtgatcc gcgcctatgg gccaaagccc      1380
     gacatgctga acggccaatg gctgcccccg cccatttcga gggaaggcga cgcccgatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page