(data stored in ACNUC7421 zone)

EMBL: AP010803.PE269

AP010803.PE269       Location/Qualifiers
FT   CDS_pept        complement(283814..284236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95103"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM1"
FT                   /protein_id="BAI95103.1"
FT                   /translation="MSGFNTILLKAGIASVALAAAAPVLAQDAAAPAQSAPAQAAPAAP
FT                   AAGASNFTDAEIKQFAAAAVEVTKIQQDSSIAAADKQPKMLAALQASGIPPEKFNQIGQ
FT                   AAAADPALQQKIQAAAPTSAAPAAPAAGAAPATPAQ"
     ttgtcgggtt ttaacaccat ccttctgaag gccgggatcg catcggtcgc gctggccgcc        60
     gccgccccgg tccttgccca ggacgccgcc gctccggccc agtccgcgcc tgcccaggct       120
     gcgcccgctg ccccggccgc tggcgccagc aatttcaccg acgctgaaat caagcagttc       180
     gccgccgcgg ccgtggaggt gacgaagatc cagcaggaca gcagcatcgc cgccgccgac       240
     aagcagccca agatgctggc ggcgctccag gcgtcgggca tcccgccgga aaagttcaac       300
     cagatcggcc aggccgcagc ggctgacccg gcgctccagc agaagatcca ggccgccgcg       360
     ccgacctcgg ccgcccccgc agctccagca gcgggcgctg ccccggcaac ccccgcgcaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page