(data stored in ACNUC7421 zone)

EMBL: AP010803.PE274

AP010803.PE274       Location/Qualifiers
FT   CDS_pept        complement(288661..289341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95108"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM6"
FT                   /protein_id="BAI95108.1"
FT                   /translation="MRPIHKLLPALALLAAPAAAHANEDEQLWTTASATVKLSDRWRFS
FT                   QEVVARFSDDRDGLYEVEMNSLIGYRIGGKVTVWAGYTHDPNYNGGDFAVMEHRGRQQV
FT                   TFDNIVKVGPGQLSARLRLEERWREGIDGTAWRLRPYVKYVLPFREGGKTALLLSHESF
FT                   IDLNTTNFQRVQGEERMRNLIAITTPIAKNVNAEIGYLHQHGFRPDADDSNDHVASFSL
FT                   GFSF"
     atgcgaccga tccacaagct gctgcccgcg ctcgccctgc tggccgcccc cgccgcggcg        60
     catgccaacg aggacgaaca gctttggacc accgccagcg cgacggtgaa gctcagcgat       120
     cgctggcgct tttcgcaaga ggtcgtcgcc cggttcagcg acgatcgcga cgggctgtac       180
     gaggtcgaga tgaattcgct gatcggctac aggatcggcg ggaaggtgac ggtctgggcg       240
     ggctacaccc acgatcccaa ttataatggc ggggacttcg cggtcatgga gcatcgcggg       300
     cgccagcagg tgaccttcga caatatcgtg aaggtcggcc ccggccagct cagcgcccga       360
     ctgcggctgg aggaacgctg gcgcgagggg atcgacggca ccgcctggcg gctgcgcccc       420
     tatgtcaaat atgtgctgcc gttccgggaa ggcggcaaaa ccgcgctgct gctcagccat       480
     gagagcttca tcgacttgaa caccaccaat ttccagcggg tgcagggcga ggagcggatg       540
     cgcaacctga tcgccatcac caccccgatc gcgaagaatg tgaatgcgga gatcggctat       600
     ctgcaccagc acggctttcg gccggacgcc gacgacagca acgaccatgt ggcgtccttt       660
     tcgctgggct tcagcttcta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page