(data stored in ACNUC7421 zone)

EMBL: AP010803.PE282

AP010803.PE282       Location/Qualifiers
FT   CDS_pept        298599..299021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95116"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN4"
FT                   /protein_id="BAI95116.1"
FT                   /translation="MGAHIVVPIPVHQTDSTLCRIPPPFRGPNLPDLILCSVNPPPMDL
FT                   GFLRTSGLKAGFVKPSGRRRVPVWPSLRAASAAAQAASPTALAVAGVLRGQEIEGDWVQ
FT                   ELADILAPRSGGNIEAVGLAGSFNPLIANLLKVGQG"
     atgggcgcgc atatagtcgt cccgatcccc gtccaccaga cggattcaac gctttgtcgc        60
     atccctccgc catttcgggg tccaaattta ccggacctta tcctttgctc cgtaaaccct       120
     cctcccatgg atctgggatt ccttcggacg agcgggctca aggccggctt cgtcaagcct       180
     tcgggccggc ggcgcgtgcc ggtctggccg tccttgcggg ccgcttcggc ggcggcgcag       240
     gcggccagcc ccaccgcgct ggcggtcgcg ggcgtcctgc gggggcagga aatcgaaggg       300
     gactgggtcc aggaactggc cgatatcctc gcgccacgtt ccggcggcaa tatcgaggcc       360
     gtggggctcg cgggcagctt caacccgttg atcgcgaacc ttttaaaagt gggacaagga       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page