(data stored in ACNUC7421 zone)

EMBL: AP010803.PE283

AP010803.PE283       Location/Qualifiers
FT   CDS_pept        299128..299427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95117"
FT                   /db_xref="GOA:D4YXN5"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN5"
FT                   /protein_id="BAI95117.1"
FT                   /translation="MIENQKIRPAQVVGPLGEPLTLESLPPVDTTRWVVRRKAEVVAAV
FT                   NGGLLTVDEACARYSLTLEEFASWQRAVDRSGMHGLRVTRIQYYKSLYERQQKY"
     atgatcgaaa accagaaaat cagacctgca caggtcgtcg ggccgctagg agaacccctg        60
     actctggaaa gcctgccgcc tgtcgacacc acgcgctggg tcgtgcgtcg caaggcggag       120
     gtcgtggcgg ccgtgaatgg cggcctgctg accgtggacg aagcctgcgc ccgctattcg       180
     ctgacgctcg aggaatttgc gagctggcag cgcgccgtcg accgttcggg catgcatggc       240
     ctgcgcgtga cgcgcatcca atattacaag tccctctacg aacggcagca gaaatactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page