(data stored in ACNUC7421 zone)

EMBL: AP010803.PE284

AP010803.PE284       Location/Qualifiers
FT   CDS_pept        299586..299840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02840"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95118"
FT                   /db_xref="GOA:D4YXN6"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN6"
FT                   /protein_id="BAI95118.1"
FT                   /translation="MGIILWLVVGGIIGWLASMVMRTDAQQGILLNIVVGIVGAFVGGL
FT                   IFSGGSINDGLTLYSFLVSLVGAIILLAIVNLVRRGSVR"
     atgggcatca tcttgtggct cgtcgtcggc ggcatcatcg gctggctcgc cagcatggtc        60
     atgcggaccg acgcacagca gggaatcctg ctcaacatcg tcgtcggcat tgtcggcgcg       120
     ttcgtcggcg gcctgatctt cagcggcggt tcgatcaatg acggcctgac gctctacagc       180
     ttcctggtgt cgctggtcgg cgccatcata ttgctggcga tcgtcaacct ggttcggcgc       240
     ggttcggttc gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page