(data stored in ACNUC7421 zone)

EMBL: AP010803.PE290

AP010803.PE290       Location/Qualifiers
FT   CDS_pept        307283..307810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95124"
FT                   /db_xref="GOA:D4YXP2"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP2"
FT                   /protein_id="BAI95124.1"
FT                   /translation="MTAGDSAFASGPAFPYIGGMAIFPRPVSPKSAMSDLWSYFRENRP
FT                   HKWPLLGLSVAFTWVIIWAFIVDANTNTMPTRNQIFYVQSWDANRTDAAIILQQKIDLA
FT                   KREAAIQKRQREMQGVADIFGIDWKKDEARNTARRKEALKQINAQLDQRLAKAEATEKS
FT                   APAPTQSGAAQP"
     atgaccgcag gcgacagcgc ttttgcatcc ggccccgcct tcccctatat cggcggcatg        60
     gcgatctttc cccgtccggt gtctcccaag agcgcgatga gcgacctgtg gagctatttt       120
     cgcgagaacc ggccccataa atggccgctg ctcggcctgt ccgtcgcgtt cacctgggtc       180
     atcatctggg ccttcatcgt cgacgcgaac accaacacca tgccgacccg caaccagatc       240
     ttctatgtgc agagctggga cgccaaccgg accgacgcgg cgatcatcct gcagcagaag       300
     atcgacctcg ccaagcgcga ggcggcgatc cagaagcggc agagggaaat gcagggcgtg       360
     gccgatattt tcggcatcga ctggaagaag gacgaggcgc gcaacaccgc ccgccgcaag       420
     gaagcgctga agcagatcaa cgcgcaactc gaccagcgtc tggccaaggc cgaagccacg       480
     gaaaaatccg cccccgcccc cacccagagc ggagcggccc agccctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page