(data stored in ACNUC7421 zone)

EMBL: AP010803.PE296

AP010803.PE296       Location/Qualifiers
FT   CDS_pept        312634..313278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02960"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein / RpsU-divergently
FT                   transcribed"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95130"
FT                   /db_xref="GOA:D4YXP8"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP8"
FT                   /protein_id="BAI95130.1"
FT                   /translation="MTLDEVRAALAPILPRHAAFDGWRGEAVAMAAEQCGIDADIAALA
FT                   FPGGAMDMIDAWFASVDSRMLDALPPEKLAALPIRQRITALVETRLTLLARDREALRRA
FT                   QAVMAMPRNAARAARLGWRAADVMWRAAGDAATDLNHYSKRLTLAGVYAATLLVFVDDE
FT                   SDHWAETRAFLARRIEGVMRFERAKARWKGVGGGERLSFARFIGRLRYPAI"
     atgacgctag acgaagtgcg cgccgcgctc gcgcccatcc tgccgcgcca cgccgccttc        60
     gacgggtggc gcggggaagc cgtggcgatg gcggcggaac aatgcggcat cgacgcagac       120
     atcgccgcgc tcgcctttcc gggcggagcg atggacatga tcgacgcctg gttcgcaagc       180
     gtcgattcgc ggatgctgga cgcgctgccg ccggaaaaac tggccgccct gccgatccgc       240
     cagcgcataa cggccctggt cgaaacccgc ctgaccctgc tggcgcggga ccgggaggcg       300
     ctgcgccggg cgcaggcggt catggccatg ccgcgcaacg cggcgcgggc cgccaggctc       360
     ggctggcggg cggcggacgt catgtggcgc gccgcgggcg acgcggcgac ggacctcaat       420
     cattacagca agcggctgac gctggcgggg gtctatgccg caaccctgct ggttttcgtc       480
     gatgacgaga gcgatcactg ggcggagacc cgcgccttcc tggcccgccg gatcgaaggc       540
     gtgatgcggt tcgagcgggc caaggcccgg tggaagggcg tcggcggggg cgagaggctg       600
     agcttcgcgc gcttcatcgg acggctgcgc taccccgcca tatga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page